DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9826 and TNA1

DIOPT Version :9

Sequence 1:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_011776.1 Gene:TNA1 / 853175 SGDID:S000003492 Length:534 Species:Saccharomyces cerevisiae


Alignment Length:399 Identity:86/399 - (21%)
Similarity:155/399 - (38%) Gaps:93/399 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQSFLLFLGLTVMHIARLNVSVAIVAMTNAATTNPNFPEFEWTEKQKSYILSSFYWGYILTLFPG 80
            |...|.||.    ::.:.|:..|.||..:        .:......|.:..::.|:..|:|....|
Yeast    95 LMGMLYFLS----NLDKSNIGNAEVAGLS--------KDIHLVGTQYNTCVTVFFATYVLFDPIG 147

  Fly    81 SFLCRRYGAKVVLFVASCGTAVLSLMTPWCITWGGWQVFCAIRILQGLFQGVIFPCVTEHLAMWS 145
            :.|.:..|..:::.:.......:||.|.|.   ..:.....:|:|.|.|:|:|:|.:..:|::..
Yeast   148 TNLLKIMGPPLMMSICLTCFGAISLGTAWV---KNYAQLIVVRLLLGAFEGMIYPAINMYLSVCY 209

  Fly   146 PPEERNRLGAFSYTGTDCGTVLAMFISGMIAKGAMGWPGISYVSGSLCAAWCFLWLI-------- 202
            ..|:.....||.::.. |   |:....|:||.|.      |.:|||| ..|.:::::        
Yeast   210 RREQYALRFAFVFSAA-C---LSSSFGGLIAYGC------SKISGSL-KDWQYIYIVEGCISLGF 263

  Fly   203 ---FA---SNNATESRFVGEAECKYIE------SSLEHNEDFHGRTIPIPWRAIWTSVPFLALLV 255
               :|   |.|..:|.|..:.|.:||.      ::.:.:|.|.       |..:|.:|..:....
Yeast   264 VPFYAFGLSKNLEDSWFFNKEEKEYISERYKTMNTFDPDEKFE-------WFQVWQAVKDVKTWA 321

  Fly   256 TRCA------ETYGLSTLQAEIPSYMNGVLNMEIQSNAVFSSLPFLAMWLLSYVYLIAADVLLKK 314
            :..|      .|:||:.....|.:.| |..|:..|    ..::|.  .:|.:.|:.|.|....:.
Yeast   322 SAVALFGIDLTTFGLTVFLPIIITSM-GFTNVRAQ----LMTVPI--YFLTAIVFFICAVWSDRI 379

  Fly   315 KILSLTAVRKLFNTLSFWIPAAALIGIGFLSEENKNLAIVLMTVSVGVN--------SGATIGSS 371
            |:.|           .|.:.|.....||        :||||.:...||.        .|..:.::
Yeast   380 KLRS-----------PFILGACLTTSIG--------IAIVLGSQVHGVRYFGVYILCMGIYVNAA 425

  Fly   372 LNSIDLSPN 380
            .|.:.||.|
Yeast   426 CNCLWLSGN 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 86/399 (22%)
MFS 19..438 CDD:119392 85/396 (21%)
TNA1NP_011776.1 MFS_FEN2_like 87..490 CDD:340885 86/399 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I1824
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.