DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9826 and THI73

DIOPT Version :9

Sequence 1:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_013104.1 Gene:THI73 / 850690 SGDID:S000003994 Length:523 Species:Saccharomyces cerevisiae


Alignment Length:450 Identity:90/450 - (20%)
Similarity:153/450 - (34%) Gaps:148/450 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SYILSSFYWGYILTLFP-----GSFLCRRYGAKVVLFVASCGTAVLSLMTPWCITWGGWQVFCAI 122
            :||.......|::..||     |:|:      .|...|.:|..|        |.|:....|   :
Yeast   127 AYIFMEPVVTYLIQKFPISKILGTFI------TVWGIVLACHAA--------CKTYASLMV---V 174

  Fly   123 RILQGLFQ-GVIFPCVTEHLAMWSPPEERNRLGAFSYTGTDCGTVLAMFISGMIAKGAMGWPGIS 186
            |.|.|||: .....|:......::..|:..|:|   :..|..||  ...:.|:|:.|.:.:.|.:
Yeast   175 RTLLGLFESSSAVGCIAISGMYYTKSEQSARIG---FWATQAGT--GYIVGGLISFGFLHYHGTA 234

  Fly   187 YVS--------GSLCAAWCFLWLIFASNNATESRFVGEAECKYIESSLEHNED------------ 231
            :.|        |.:..|:..|..::..:|.|.:.|:.:.|...:...:..|:.            
Yeast   235 FTSWQIMFLVVGLVTVAFGVLTFLYLPDNVTNAWFLNKEEKIQVVEHIRANQTGLETKKFKKQQV 299

  Fly   232 ----FHGR-TIPIPWRAIWTSVPFLALLVTRCAE--TYGLSTLQAEIPSYMNGVLNMEIQSNAVF 289
                .|.: |.|:             ||:|.|::  |..:.|....|    .|....:....|:.
Yeast   300 KELFLHDKFTWPM-------------LLLTACSQISTGAIGTFSVTI----TGTFGFDKYETALL 347

  Fly   290 SSLPFLAMWLLSYVYLIAADVLLKKKILSLTAVRKLFNTLSFWIPAAALIGIGFLSEENKNLAIV 354
             .||..|  :.:.:.||...:|.:...::|.       |.|.:||  |:||           .||
Yeast   348 -QLPIGA--ITAMIILITTQMLSRWGHITLI-------TTSMYIP--AIIG-----------CIV 389

  Fly   355 LMTVSVGVNSGATIGSSLNSIDLSPNHAGILIGLSNTVANVIPILTPLIAGEIVADK-------H 412
            |                            |.:.||:.:.|:..:.. |.:|..|...       :
Yeast   390 L----------------------------ISLPLSHKIGNLFSLYL-LYSGSCVITNIYIWNSCN 425

  Fly   413 NRGQWQIVFGLAAVIFFVGNVVFIIWGTAKAQPWDADDFLKPKDTESACEKPKITPAEVA 472
            ..|..:.|| ..|:...|.||..||          |....:      |...|:..||::|
Yeast   426 TSGYTKRVF-RNAITMIVYNVSCII----------APQMFR------AYSAPRYIPAKIA 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 85/426 (20%)
MFS 19..438 CDD:119392 83/414 (20%)
THI73NP_013104.1 MFS_FEN2_like 77..481 CDD:340885 89/449 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I1824
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X142
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.