DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9826 and CG18788

DIOPT Version :9

Sequence 1:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_652665.3 Gene:CG18788 / 59164 FlyBaseID:FBgn0042126 Length:540 Species:Drosophila melanogaster


Alignment Length:411 Identity:104/411 - (25%)
Similarity:183/411 - (44%) Gaps:58/411 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EWTEKQKSYILSSFYWGYILTLFPGSFLCRRYGAKVVLFVASCGTAVLSLMTPWCITWGGWQVFC 120
            :|..:.:|.::.:||.||:|:..||..|..|||.|.||..|...:|||:|:||..:..||.....
  Fly   134 QWPRQTQSLVVMAFYAGYVLSHVPGGRLAERYGGKWVLSAAILTSAVLTLLTPTAVRQGGLYALV 198

  Fly   121 AIRILQGLFQGVIFPCVTEHLAMWSPPEERNRLGAFSYTGTDCGTVLAMFISGMIAKGAMGWPGI 185
            |:|:|.|:.:|..||.|...||.|.|.:||..|.:...:|.:.|..:...:||::. ....||..
  Fly   199 AVRLLVGICEGPCFPAVCALLAQWVPEQERGMLASCVLSGGEIGITMVQLVSGLLI-AEQDWPVF 262

  Fly   186 SYVSGSLCAAWCFLWLIFASNNATESRFVGEAECKYIESSL------------------------ 226
            .|:.|....||...:.:...:......|:...|.:||..:.                        
  Fly   263 FYLVGGGAVAWFLGFTLVCYSTPDHCPFIQSEEREYIRCNTSNSFLLTTGREREEMDGEDGYEGE 327

  Fly   227 --EHNEDFHGRTIPIPWRAIWTSVPFLALLVTRCAETYGLSTLQAEIPSYMNGVLNMEIQSNAV- 288
              ||..:........|||::..|.|..||:.|...:.:     |.::|..:...|. |:::... 
  Fly   328 DREHRREVEATCNTAPWRSMLNSTPLWALVSTSMQQEF-----QQKLPQELQIALE-EVRARGTS 386

  Fly   289 FSSL--------PFLAMWLLSYVYLIAADVLLKKKILSLTAVRKLFNTLSFWIPAAALIGIGFLS 345
            ||.|        |.:..|:.|......:|||::::||:.|..|:|.:.|.|      |.|..::.
  Fly   387 FSELTTIIETIAPSVGNWIASLTTGRLSDVLIEQQILTRTQTRRLMSWLVF------LCGSMYML 445

  Fly   346 EENKNLAIVLMTVSVGVNSGATIGSSLNSIDLSPNHAGILIGLSNTVANVIPILTPLIAGEIVAD 410
            :...:.|.:...:.:|....:.   .|..:|:|||:||.|:|:|..:..:..:|.|.:. ::..|
  Fly   446 QIKMSGARIWSVLGMGAYYASI---KLLPLDMSPNYAGTLMGISGGMGALPALLMPYLE-QLETD 506

  Fly   411 KHNRGQWQIVFGLAAVIFFVG 431
                  :::|..:.|.::.:|
  Fly   507 ------YKLVSSVRAAMWVIG 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 104/411 (25%)
MFS 19..438 CDD:119392 104/411 (25%)
CG18788NP_652665.3 MFS 129..>280 CDD:119392 50/146 (34%)
MFS_1 135..498 CDD:284993 99/378 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X142
66.060

Return to query results.
Submit another query.