DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9826 and CG7091

DIOPT Version :9

Sequence 1:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_650243.2 Gene:CG7091 / 41590 FlyBaseID:FBgn0038099 Length:509 Species:Drosophila melanogaster


Alignment Length:495 Identity:107/495 - (21%)
Similarity:200/495 - (40%) Gaps:59/495 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VRHLQSFLLFLGLTVMHIARLN-VSVAIVAMT--------------------NAATT-------- 48
            ||...:...||. |.:|.|..| :.:.|:.|.                    |..:|        
  Fly    26 VRLTYAICAFLA-TCLHAAMRNMLGMIILKMVMPRPEDALVVPAGLSRLTEGNVTSTGRCGSPRV 89

  Fly    49 --NPNFPEFE-----WTEKQKSYILSSFYWGYILTLFPGSFLCRRYGAKVVLFVASCGTAVLSLM 106
              ||...|.:     ||..|:......:|:||::::....:|..|..:|.:..|:....||..::
  Fly    90 VFNPQIQETQSGDLPWTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAVAYIL 154

  Fly   107 TPWCITWGGWQVFCAIRILQGLFQGVIFPCVTEHLAMWSPPEERNRLGAFSYTGTDCGTVLAMFI 171
            .| .:....::......::.||..|...|.:.:....|:.|.||..|.:|:|:|...|::|...:
  Fly   155 LP-AMAHSSFEAGVVDLVICGLLAGCGNPAMYKLFVTWAHPTERTALLSFAYSGLLMGSMLVYPV 218

  Fly   172 SGMIAKGAMGWPGISYVSG----SLCAAWCFLWLIFASNNATESRFVGEAECKYIESSLEHNEDF 232
            :..::.  .||....||.|    |...|.|||    ..:...:...:...|..|:..........
  Fly   219 ASYLSN--FGWELSFYVVGGVGLSFGIACCFL----VYDTVEQHPRISNEEVDYLRQGKSQLGQQ 277

  Fly   233 HGRTIPIPWRAIWTSVPFLALLVTRCAETYGLSTLQAEIPSYMNGVLNMEIQSNAVFSSLPFLAM 297
            ....:.|||:::..:.|..|.::|....||....:...:|.:|...:..:::.....|:.|:|. 
  Fly   278 RQPVVTIPWKSLLAAPPVYAFILTHMFHTYTFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLG- 341

  Fly   298 WLLSYVYLIAADVLLKKKI-LSLTAVRK-LFNTLSFWIPAAALIGIGFLSE-ENKNLAIVLMTVS 359
            .:.|.|..|.....::::: .....||: |:...|  |...:|||:..|:. ::|.|.:|:....
  Fly   342 GICSKVMCILGGSYVERRVGPDQNCVRRMLYGICS--ILTTSLIGVIILANCDDKILVLVMFAFM 404

  Fly   360 VGVNSGATIGSSLNSIDLSPNHAGILIGLSNTVANVIPILTPLIAGEIVADKH--NRGQWQIVFG 422
            :........|.....:..:|:.||:|.||:|.:|::...|.|.:...:|   |  ::.:|.:|..
  Fly   405 MATTDMGFSGYWPTLLYFAPSFAGLLSGLANGMAHLSGFLAPHLVAALV---HTGSKDEWNVVLM 466

  Fly   423 LAAVIFFVGNVVFIIWGTAKAQPWDADDFLKPKDTESACE 462
            ...|...:..:||....:...||||....::...:.||.|
  Fly   467 TLIVFNTMAMLVFAFCSSTNLQPWDPRSRMEKTASPSAQE 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 103/480 (21%)
MFS 19..438 CDD:119392 98/463 (21%)
CG7091NP_650243.2 2A0114euk 77..498 CDD:129972 94/433 (22%)
MFS 115..482 CDD:119392 82/379 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 1 1.000 - - mtm14983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.