DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9826 and CG3649

DIOPT Version :9

Sequence 1:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_611725.2 Gene:CG3649 / 37626 FlyBaseID:FBgn0034785 Length:486 Species:Drosophila melanogaster


Alignment Length:483 Identity:195/483 - (40%)
Similarity:298/483 - (61%) Gaps:10/483 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KGPRLGVRHLQSFLLFLGLTVMHIARLNVSVAIVAMTNAATTNPNFPEFEWTEKQKSYILSSFYW 71
            |||..||||||...|||..|::...|.|:||||||.|||.::|||:||:..||.||||.:||.:|
  Fly    11 KGPMWGVRHLQVLFLFLCATLIVAQRFNMSVAIVAFTNANSSNPNYPEYRLTEPQKSYTISSPFW 75

  Fly    72 GYILTLFPGSFLCRRYGAKVVLFVASCGTAVLSLMTPWCITWGGWQVFCAIRILQGLFQGVIFPC 136
            |...|.....:|..|:||||:|......||:||:.||:.:.|||||:...:|.:|||..|.::||
  Fly    76 GSCCTQMMSGYLSSRFGAKVLLLTIMLLTALLSIATPFALAWGGWQLLFWVRFVQGLAMGGMWPC 140

  Fly   137 VTEHLAMWSPPEERNRLGAFSYTGTDCGTVLAMFISGMIAKGAMGWPGISYVSGSLCAAWCFLWL 201
            :..|||.|.|.:|.||:|....||.||||::...:||:::...:|||...||.|.|...||..:|
  Fly   141 LYTHLAKWCPKKEANRMGGIMTTGLDCGTIMGFALSGVLSASPLGWPSTFYVPGYLGIVWCLTFL 205

  Fly   202 IFASNNATESRFVGEAECKYIESSLEHNEDFHGRTIPIPWRAIWTSVPFLALLVTRCAETYGLST 266
            .:.:|:.:||:|:..||.|:|:.:||.|:...|.|.|:||..|.||.||:.|...:.::.....|
  Fly   206 RYGANSPSESKFISLAERKHIQFALEQNQVIRGATPPVPWLQILTSRPFIVLAFCKMSQACSFYT 270

  Fly   267 LQAEIPSYMNGVLNMEIQSNAVFSSLPFLAMWLLSYVYLIAADVLLKKKILSLTAVRKLFNTLSF 331
            |..:||.|::|:.:..|.:||:.|:|||:.|.:.||.::..|:.|.:::.:||..:||..|:.:.
  Fly   271 LMQQIPRYIHGIFHYSIAANALLSALPFVVMLMSSYGFIFLAEYLTRRRDISLPILRKTINSFAT 335

  Fly   332 WIPAAALIGIGFLSEENKNLAIVLMTVSVGVNSGATIGSSLNSIDLSPNHAGILIGLSNTVANVI 396
            |.||.||:.:.::|::|...::..:..:....||..||||||.:|||||.||:|.|:|||:.:..
  Fly   336 WTPAVALVILSYVSDQNVVGSMFCLIAATAAISGQAIGSSLNHVDLSPNFAGLLFGMSNTLMSAA 400

  Fly   397 PILTPLIAGEIVADKHNRGQWQIVFGLAAVIFFVGNVVFIIWGTAKAQPWDADDFLKPKDTESAC 461
            .:::|::.|..|..:.:|.||:.||...:||.|:||::::|:|....|.|: |...|..:|| |.
  Fly   401 GVISPIVIGLTVTKESDRSQWRTVFLGISVILFLGNLMYLIFGQMTVQSWN-DSPSKETETE-AS 463

  Fly   462 EKPKITPAEVAPPIDPVLEQQISWPERY 489
            .||:.:...||       |:.|| .||:
  Fly   464 PKPQASAPSVA-------EETIS-VERF 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 176/435 (40%)
MFS 19..438 CDD:119392 168/418 (40%)
CG3649NP_611725.2 MFS 22..442 CDD:119392 168/419 (40%)
2A0114euk 23..458 CDD:129972 174/435 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442688
Domainoid 1 1.000 46 1.000 Domainoid score I8188
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428976at33208
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 1 1.000 - - mtm14983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.