DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9826 and CG3036

DIOPT Version :9

Sequence 1:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001260058.1 Gene:CG3036 / 33695 FlyBaseID:FBgn0031645 Length:493 Species:Drosophila melanogaster


Alignment Length:467 Identity:131/467 - (28%)
Similarity:225/467 - (48%) Gaps:42/467 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LGVRHLQSFLLFLGLTVMHIARLNVSVAIVAM--------TNA----------ATTNPN----FP 53
            |..|.:.:.|..||..:.:..|:|:::|||.|        .||          :|.:|:    :.
  Fly    16 LSCRQVLNLLTMLGFMLNYALRVNLTIAIVDMVRPNVTSAVNATLVGNSTAANSTASPDGVDVYE 80

  Fly    54 E-FEWTEKQKSYILSSFYWGYILTLFPGSFLCRRYGAKVVLFVASCGTAVLSLMTPWCITWGGWQ 117
            | |.|...|.:::|..|:||||||..||..|....|.:.|...:....::|:|:|| ......:.
  Fly    81 ERFPWDSYQTNFVLGCFFWGYILTELPGGRLAELIGGRRVFGHSMLWASLLTLITP-LAAHINYV 144

  Fly   118 VFCAIRILQGLFQGVIFPCVTEHLAMWSPPEERNRLGAFSYTGTDCGTVLAMFISGMIAKGAMGW 182
            |...:|::.|...|..:|.:....|:|.||.||::..: :...:..|..:.|.|.|.:...| ||
  Fly   145 VLIVVRVVLGFMLGASWPAIHPVAAVWIPPMERSKFMS-NMMASSLGAAITMPICGYLISVA-GW 207

  Fly   183 PGISYVSGSLCAAWCFLWLIFA-SNNATESRFVGEAECKYIESSLEHNEDFHGRTIP------IP 240
            ..:.|::|::...|...|..|. ...||..|...| |.:.||.::       |.|..      :|
  Fly   208 ASVFYLTGAVGLLWSLAWFTFVYETPATHPRISAE-ERREIEEAI-------GTTTSKKRPSHVP 264

  Fly   241 WRAIWTSVPFLALLVTRCAETYGLSTLQAEIPSYMNGVLNMEIQSNAVFSSLPFLAMWLLSYVYL 305
            |..:..|....|:::......:|..|:..::|::|:.:|:.:|:.|.:|||||:|..::::....
  Fly   265 WGQLLCSPAVWAIIICHGLAVFGFFTVVNQLPTFMSKILHFDIKQNGLFSSLPYLGKYVMAVASS 329

  Fly   306 IAADVLLKKKILSLTAVRKLFNTLSFWIPAAALIGIGFLSEENKNLAIVLMTVSVGVNSGATIGS 370
            ..||.|.||..||.||.||||.|.:..||...:|...||..: ...::.:.::::..:...|.|.
  Fly   330 YLADYLRKKGTLSTTATRKLFTTFALVIPGLLMIVQVFLGYD-ATWSVTIFSLALFAHGAVTAGY 393

  Fly   371 SLNSIDLSPNHAGILIGLSNTVANVIPILTPLIAGEIVADKHNRGQWQIVFGLAAVIFFVGNVVF 435
            ..|.:|::||..|.:.||:||:::....|:..:.|.:.....:...|||||.:.|..:....|||
  Fly   394 LGNGLDIAPNFGGTIFGLANTLSSFGGFLSTSMVGALTYKDQSFHSWQIVFWILAATYISAAVVF 458

  Fly   436 IIWGTAKAQPWD 447
            .|.|:.:.|||:
  Fly   459 AILGSGELQPWN 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 130/464 (28%)
MFS 19..438 CDD:119392 124/448 (28%)
CG3036NP_001260058.1 2A0114euk 19..477 CDD:129972 130/464 (28%)
MFS 83..461 CDD:119392 110/389 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 1 1.000 - - mtm14983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X142
77.060

Return to query results.
Submit another query.