DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9826 and MFS18

DIOPT Version :9

Sequence 1:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_608835.1 Gene:MFS18 / 33650 FlyBaseID:FBgn0025684 Length:439 Species:Drosophila melanogaster


Alignment Length:449 Identity:119/449 - (26%)
Similarity:195/449 - (43%) Gaps:70/449 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LFLGLTVMHIARLNVSVAIVAMTNAATTNPNFPEFEWTEKQKSYILSSFYWGYILTLFPGSFLCR 85
            |..|..:::..|..:.:.:.|:.:|.         :|::.....:||||:|||.||...|.:...
  Fly    33 LITGTCMLYSTRTTMPLLVPAVASAQ---------KWSKTDSGTVLSSFFWGYTLTQVVGGYFSD 88

  Fly    86 RYGAKVVLFVASCGTAVLSLMTPWCITWGGWQV-------FCAIRILQGLFQGVIFPCVTEHLAM 143
            |:|.:.|:..|:.|.::::.:.| .|.|....:       ..|||||.|..|||.||.:....:.
  Fly    89 RFGGQRVILFAAIGWSLITFLMP-TIIWTAGSIKSYAIPFIVAIRILNGALQGVHFPSMISLTSQ 152

  Fly   144 WSPPEERNRLGAFSYTGTDCGTVLAMFISGMIAKGAMGWPGISYVSGSLCAAWCFLWLIFAS--- 205
            ...|.||:........|:..||:|. .|.|.......||..:..|.|.:..||..:...:|.   
  Fly   153 NLCPNERSSFFGLLTAGSALGTLLT-GIMGSFLLDYFGWSYVFRVIGLMGIAWALVLRYYAMAGE 216

  Fly   206 -----NNATESRFVGEAECKYIESSLEHNEDFHGRTIPIPWRAIWTSVPFLALLVTRCAETYGLS 265
                 |.||.||....      :|..|        |..:||...:..:.|.|.::|...|.....
  Fly   217 RNRIINIATPSRLCAN------KSPAE--------TSAVPWLRYFRRLSFWACVLTHACEMNCFF 267

  Fly   266 TLQAEIPSYMNG--------VLNMEIQSNAVFSSLPFLAM--WLLSYVYLIAADVLLKKKILSLT 320
            .|.:.:|:|.:.        |:||          :|:||:  ..|...||...  ||.:: ...|
  Fly   268 VLLSWLPTYFHDGFPHAKGWVVNM----------IPWLALPPCTLFAKYLTTR--LLARE-WHTT 319

  Fly   321 AVRKLFNTLSFWIPAAALIGIGFLSEENK-NLAIVLMTVSVGVNSGATIGSSLNSIDLSPNHAGI 384
            .|||:..:..|   ||..:.:..:|..:. :.|::.||:.:|.........::|..||:|.|:|.
  Fly   320 TVRKVIQSCCF---AAQNLALFVMSRTSDFHTALICMTIIIGGTGFHNNAVTVNPQDLAPLHSGS 381

  Fly   385 LIGLSNTVANVIPILTPLIAGEIVADKHNRGQWQIVFGLAAVIFFVGNVVFIIWGTAKA 443
            :.||.|||..:...|...:||.|:....:   |.:||..||.|..||.::||::|:|:|
  Fly   382 VFGLMNTVGAIPGFLGVYLAGHILELTQS---WPMVFSAAAGINLVGWIIFIVFGSAEA 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 119/449 (27%)
MFS 19..438 CDD:119392 116/442 (26%)
MFS18NP_608835.1 MFS 30..432 CDD:119392 116/442 (26%)
MFS_1 32..397 CDD:284993 102/404 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452000
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.