DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9826 and Slc17a4

DIOPT Version :9

Sequence 1:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_795990.2 Gene:Slc17a4 / 319848 MGIID:2442850 Length:492 Species:Mus musculus


Alignment Length:461 Identity:134/461 - (29%)
Similarity:235/461 - (50%) Gaps:36/461 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VRHLQSFLLFLGLTVMHIARLNVSVAIVAMT---------NAATTNP---------------NFP 53
            :||..:|:|.|....::..::|:|.||.||.         ||:|..|               ..|
Mouse    32 LRHGLAFILHLCNFSIYTQQMNLSFAITAMVNTTVASSQLNASTERPPTNSQDVWNETLQESKAP 96

  Fly    54 EFEWTEKQKSYILSSFYWGYILTLFPGSFLCRRYGAKVVLFVASCGTAVLSLMTPWCITWGGWQV 118
            .::||.:.:..:|||..:|..:...|..::...:|||.|:.:....::||:|..|.... .|..:
Mouse    97 VYDWTPEIQGILLSSLSYGSFIAPIPTGYVAGVFGAKYVVGLGLLISSVLTLFIPLAAD-AGVAL 160

  Fly   119 FCAIRILQGLFQGVIFPCVTEHLAMWSPPEERNRLGAFSYTGTDCGTVLAMFISGMIAKGAMGWP 183
            ...:|::||:.|.::........|.|:||:||::|...:.:|:..||.|.:...|:|.: |:|||
Mouse   161 LIVLRVIQGMAQVMVLTGQYSLWAKWAPPQERSQLITIAASGSMLGTFLVLIAGGLICQ-ALGWP 224

  Fly   184 GISYVSGSLCAAWCFLWLIFASNNATESRFVGEAECKYIESSLEHNEDFHGRTIPIPWRAIWTSV 248
            .|.|:.|.:..|.|.||.....::.....|:...|.:||..||...:...|.::||  :|:..|:
Mouse   225 YIFYIFGGIGCACCLLWFPLVYDDPQNHPFISTGERRYITCSLAQEDCSLGWSLPI--KAMVKSL 287

  Fly   249 PFLALLVTRCAETYGLSTLQAEIPSYMNGVLNMEIQSNAVFSSLPFLAMWLLSYVYLIAADVLLK 313
            |..|::|:...|.:.|||:.|..|:|::.||...::.:.:.|:|||:...:...:..:.||.||.
Mouse   288 PLWAIVVSYFCEYWLLSTVMAYTPTYISSVLQANLRDSGILSALPFMFGCVCIILGGLLADFLLS 352

  Fly   314 KKILSLTAVRKLFNTLSFWIPAAALIGIGFL-SEENKNLA-IVLMTVSVGV-NSGATIGSSLNSI 375
            :|||.|..:||||..:.....:..|:.:.:: |..:..:| :||.:|...: :|||.|    |.:
Mouse   353 RKILRLVTIRKLFTAVGVLASSGILLPLPWVRSSRSTTMAFLVLSSVFASLCDSGALI----NFL 413

  Fly   376 DLSPNHAGILIGLSNTVANVIPILTPLIAGEIVADKHNRGQWQIVFGLAAVIFFVGNVVFIIWGT 440
            |::|.:||.|.||....:.:...:.|.:||..::.....| |:.||.|||.|..||.:.::|:..
Mouse   414 DIAPRYAGFLKGLLQVFSYLAGGIAPTVAGFFISQDSEFG-WRNVFFLAAAIDVVGLLFYLIFSR 477

  Fly   441 AKAQPW 446
            |:.|.|
Mouse   478 AEVQDW 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 134/460 (29%)
MFS 19..438 CDD:119392 128/445 (29%)
Slc17a4NP_795990.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
2A0114euk 27..486 CDD:129972 134/461 (29%)
MFS 98..475 CDD:119392 114/385 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.