DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9826 and Slc17a2

DIOPT Version :9

Sequence 1:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_038951630.1 Gene:Slc17a2 / 306950 RGDID:1308821 Length:487 Species:Rattus norvegicus


Alignment Length:460 Identity:127/460 - (27%)
Similarity:231/460 - (50%) Gaps:39/460 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VRHLQSFLLFLGLTVMHIARLNVSVAIVAMTNA------ATTNPNFP------------------ 53
            |.|..:|       .|...|:::|:||:||.|:      |..:...|                  
  Rat    32 VMHFSNF-------TMITQRVSLSIAIIAMVNSTQHQDPANASAEGPVMNLLSNRSRGIKDFSTR 89

  Fly    54 --EFEWTEKQKSYILSSFYWGYILTLFPGSFLCRRYGAKVVLFVASCGTAVLSLMTPWCITWGGW 116
              .::|:.:.:..|.||..:|.||||.|..:|...:|||.:|......:::|:|.||....:|..
  Rat    90 AAVYQWSTETQGIIFSSISYGIILTLIPSGYLAGIFGAKQILGAGLLISSLLTLFTPLAADFGVI 154

  Fly   117 QVFCAIRILQGLFQGVIFPCVTEHLAMWSPPEERNRLGAFSYTGTDCGTVLAMFISGMIAKGAMG 181
            .|. .||.:||:.||:.:.......|.|:||.||::|.:.:.:|...|:.:.:.:.|:|:: |:|
  Rat   155 LVI-VIRTVQGMAQGMSWTGQFTIWAKWAPPLERSKLTSIAGSGAAFGSFIILCVGGLISQ-ALG 217

  Fly   182 WPGISYVSGSLCAAWCFLWLIFASNNATESRFVGEAECKYIESSLEHNEDFHGRTIPIPWRAIWT 246
            ||.|.|:.||:....|.||.....::......:...|.:||.||:........|:|||  :|:..
  Rat   218 WPFIFYIFGSIGCVCCVLWFTMIYDDPMHHPCISVKEKEYITSSVAQQSSSPRRSIPI--KAMVR 280

  Fly   247 SVPFLALLVTRCAETYGLSTLQAEIPSYMNGVLNMEIQSNAVFSSLPFLAMWLLSYVYLIAADVL 311
            .:|..|:.:...:..:..:.:...:|:|::.||::.|:.:.|.|||||:|....:.:....||.|
  Rat   281 CLPLWAIFMGFFSHFWLCTIIITYLPTYISTVLHVNIRDSGVLSSLPFIAASSCTILGGQMADFL 345

  Fly   312 LKKKILSLTAVRKLFNTLSFWIPAAALIGIGFLSEENKNLAIVLMTVSVGVNSGATIGSSLNSID 376
            |.:.:|||..|||||::|...:|:...:.:.|:: .:....|||:.:..|.::....|..:|::|
  Rat   346 LSRNLLSLITVRKLFSSLGLLLPSLCAVALPFVT-SSYIATIVLLILIPGTSNLCDSGFIINTLD 409

  Fly   377 LSPNHAGILIGLSNTVANVIPILTPLIAGEIVADKHNRGQWQIVFGLAAVIFFVGNVVFIIWGTA 441
            ::|.:|..|:|:|........|::....|.:::.....| |:.||.|:|.:...|.:.::|:|.|
  Rat   410 VAPRYASFLMGISRGFGLTAGIISSTTTGFLISQDSESG-WRNVFFLSAAVNMFGLIFYLIFGQA 473

  Fly   442 KAQPW 446
            :.|.|
  Rat   474 EIQNW 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 126/459 (27%)
MFS 19..438 CDD:119392 120/444 (27%)
Slc17a2XP_038951630.1 MFS_SLC17 30..471 CDD:340876 123/451 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.