DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9826 and Slc37a4

DIOPT Version :9

Sequence 1:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_038936893.1 Gene:Slc37a4 / 29573 RGDID:62066 Length:450 Species:Rattus norvegicus


Alignment Length:464 Identity:103/464 - (22%)
Similarity:160/464 - (34%) Gaps:93/464 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LFLGLTVMHIARLNVSVAIVAMTNAATTNPNFPEFEWTEKQKSYILSSFYWGYILTLFPGSFLCR 85
            :|.|.::.:..|...|..:.::.:         |....:.....|.||....|.::.|....|..
  Rat    17 MFGGYSLYYFNRKTFSFVMPSLVD---------EIALDKDDLGLITSSQSAAYAISKFVSGVLSD 72

  Fly    86 RYGAKVVLFVASCGTAVLSLMT---PWCITWGGWQVFCAIRILQGLFQGVIFPCVTEHLAMWSPP 147
            :..|:   ::.|.|..::.|:.   .|..|   ...|.|:..|.||.||:.:|...:.|..|..|
  Rat    73 QMSAR---WLFSSGLLLVGLVNVVFSWSST---VTAFAALWFLNGLAQGLGWPPCGKILRKWFEP 131

  Fly   148 EERNRLGAFSYTGTDCGTVLAMFISGMIAKGAMGWPGISYVSGSLCAAWCFLWLIFASNNATE-- 210
            .:.....|...|..:....|...::.::|: :..|.....:|||||....|..|:...|...:  
  Rat   132 SQFGTWWAVLSTSMNLAGSLGPILATILAQ-SYSWRSTLALSGSLCVVVSFFCLLLIHNEPADVG 195

  Fly   211 SRFVGEAECKYIESSLEHNEDFHGRTIPIPWRAIWTSVPFLALLVTRCAETYGLSTLQAEIPSYM 275
            .|.:..|..|..:.|.:.........:.          |:|.:|.|.....:|:.|...:...:.
  Rat   196 LRNLDPAPSKGKKGSSKEESTLQDLLLS----------PYLWVLSTGYLVVFGVKTCCTDWGQFF 250

  Fly   276 NGVLNMEIQSNAVFSSLPFLAMWLLSYVYLIAA----DVLLKKKILS----------------LT 320
               |..|...:|:..|....|:.:...|..|||    |..:.|..||                :.
  Rat   251 ---LIQERGQSALVGSSYISALEVGGLVGSIAAGYLSDRAMAKAGLSVYGNPRHSLLLLMMAGMA 312

  Fly   321 AVRKLFNTL--------SFWIPA----AALIGIGFLSEENKNLAIVLMTVSVGVNSGATIG-SSL 372
            |...||...        :||.||    |.|.|.    .|::...:||         ||..| ||.
  Rat   313 ASMFLFRVTVTSDSPKEAFWTPALHPLAELTGF----TEHEIWILVL---------GAVFGFSSY 364

  Fly   373 NSIDL---------SPNHAGILIGLSNTVANVIPILTPLIAGEIVADKHNRGQWQIVFGLAAVIF 428
            ..|.|         .||..|....:...:|||...|..|....|.  ||.  .|...|.:|.||.
  Rat   365 GPIALFGVIANESAPPNLCGTSHAIVGLMANVGGFLAGLPFSTIA--KHY--SWSTAFWVAEVIC 425

  Fly   429 FVGNVVFII 437
            ....|||.:
  Rat   426 IASTVVFFL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 103/464 (22%)
MFS 19..438 CDD:119392 103/464 (22%)
Slc37a4XP_038936893.1 MFS_SLC37A4 10..438 CDD:340901 103/464 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342579
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.