DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9826 and SPAC1B3.15c

DIOPT Version :9

Sequence 1:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_594800.1 Gene:SPAC1B3.15c / 2542116 PomBaseID:SPAC1B3.15c Length:628 Species:Schizosaccharomyces pombe


Alignment Length:338 Identity:70/338 - (20%)
Similarity:115/338 - (34%) Gaps:117/338 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 FCAIRILQGLFQGVIFPCVT---------EHLAMWSPPEERNRLGAFSYTGTDCGTVLAMFISGM 174
            |.|:|...||....::|...         :||.        .|:|.: ||.....:|....:|..
pombe   259 FIALRFFNGLAIAGMWPGFAFYTSRFYRDQHLG--------KRIGWY-YTAAQISSVATSLLSAA 314

  Fly   175 IAK--GAMGWPGISYVSGSLCAAWCFL-WLIFASNNATESRFVGE-AECKYIESSLEHNEDFHGR 235
            ..|  |..|..|..         |.|| |.:.|   .|:..|:.. ..|      ::||:  |..
pombe   315 FQKMDGLHGLYGYQ---------WMFLIWGVVA---FTQGLFLPRWLPC------IKHNQ--HNE 359

  Fly   236 TIPIPWRAIWTSVP-FLALLVTRCAETYGLSTLQAEIPSYMNGVLNMEIQSNAVFSSLPFLAMWL 299
                .|.: |..:| ||..|  :.:|..||:..:.|:.:                          
pombe   360 ----KWIS-WIRIPKFLGFL--KASENTGLTPEEEEVHA-------------------------- 391

  Fly   300 LSYVYLIAADVLLKKKILSLTAVRKLFNTLSFWIPAAALIGIGFLSEENKNLAIVLMTVSVGVNS 364
               :|:....|   .|..:||.:...|..:..|.|.....|:                  ||:::
pombe   392 ---IYMAEMQV---GKSWTLTDLADAFLDVRLWPPIFMFFGV------------------VGISN 432

  Fly   365 GATIGSSLNSIDLSPNHAGILIGLSNT---VANVIPILTPLIAGEIVADKHNRGQWQIVFGLAAV 426
            |....|||...:::.|.:.:.:.|...   |.:.|.|||       |...|:|..       ..:
pombe   433 GLVNYSSLIISEINENFSSVTVSLLVAPIWVFDAIAILT-------VLPLHDRFH-------KKM 483

  Fly   427 IFFVGNVVFIIWG 439
            :||||:.:|::.|
pombe   484 LFFVGSCLFVLAG 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 70/338 (21%)
MFS 19..438 CDD:119392 69/335 (21%)
SPAC1B3.15cNP_594800.1 MFS 158..600 CDD:119392 70/338 (21%)
2A0114 190..600 CDD:273326 70/338 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.