DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9826 and SLC37A4

DIOPT Version :9

Sequence 1:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001157750.1 Gene:SLC37A4 / 2542 HGNCID:4061 Length:451 Species:Homo sapiens


Alignment Length:470 Identity:103/470 - (21%)
Similarity:162/470 - (34%) Gaps:104/470 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LFLGLTVMHIARLNVSVAIVAMTNAATTNPNFPEFEWTEKQKSYILSSFYWGYILTLFPGSFLCR 85
            :|.|.::.:..|...|..:.::..         |....:....:|.||....|.::.|....|..
Human    17 MFGGYSLYYFNRKTFSFVMPSLVE---------EIPLDKDDLGFITSSQSAAYAISKFVSGVLSD 72

  Fly    86 RYGAKVVLFVASCGTAVLSLMT---PWCITWGGWQVFCAIRILQGLFQGVIFPCVTEHLAMWSPP 147
            :..|:   ::.|.|..::.|:.   .|..|   ..||.|:..|.||.||:.:|...:.|..|..|
Human    73 QMSAR---WLFSSGLLLVGLVNIFFAWSST---VPVFAALWFLNGLAQGLGWPPCGKVLRKWFEP 131

  Fly   148 EERNRLGAFSYTGTDCGTVLAMFISGMIAKGAMGWPGISYVSGSLCAAWCFLWLIFASNNATESR 212
            .:.....|...|..:....|...::.::|: :..|.....:||:||....||.|:...|...:  
Human   132 SQFGTWWAILSTSMNLAGGLGPILATILAQ-SYSWRSTLALSGALCVVVSFLCLLLIHNEPAD-- 193

  Fly   213 FVG-------EAECKYIESSLEHNEDFHGRTIPIPWRAIWTSVPFLALLVTRCAETYGLSTLQAE 270
             ||       .:|.|  :.||:.........:.          |:|.:|.|.....:|:.|...:
Human   194 -VGLRNLDPMPSEGK--KGSLKEESTLQELLLS----------PYLWVLSTGYLVVFGVKTCCTD 245

  Fly   271 IPSYMNGVLNMEIQSNAVFSSLPFLAMWLLSYVYLIAA----DVLLKKKILS------------- 318
            ...:.   |..|...:|:..|....|:.:...|..|||    |..:.|..||             
Human   246 WGQFF---LIQEKGQSALVGSSYMSALEVGGLVGSIAAGYLSDRAMAKAGLSNYGNPRHGLLLFM 307

  Fly   319 ---LTAVRKLFNT---------LSFWI----PAAALIGIGFLSEENKNLAIVLMTVSVGVNSGAT 367
               :|....||..         ::||.    |.|.|.|.    .|::...:||         ||.
Human   308 MAGMTVSMYLFRVTVTSDSPKDVAFWTLALHPLAELTGF----TEHELWILVL---------GAV 359

  Fly   368 IG-SSLNSIDL---------SPNHAGILIGLSNTVANVIPILTPLIAGEIVADKHNRGQWQIVFG 422
            .| ||...|.|         .||..|....:...:|||...|..|....|.  ||.  .|...|.
Human   360 FGFSSYGPIALFGVIANESAPPNLCGTSHAIVGLMANVGGFLAGLPFSTIA--KHY--SWSTAFW 420

  Fly   423 LAAVIFFVGNVVFII 437
            :|.||.......|.:
Human   421 VAEVICAASTAAFFL 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 103/470 (22%)
MFS 19..438 CDD:119392 103/470 (22%)
SLC37A4NP_001157750.1 MFS 14..437 CDD:119392 103/470 (22%)
2A0104 18..419 CDD:273319 98/451 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148684
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.