DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9826 and SLC17A2

DIOPT Version :9

Sequence 1:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001273052.1 Gene:SLC17A2 / 10246 HGNCID:10930 Length:478 Species:Homo sapiens


Alignment Length:479 Identity:133/479 - (27%)
Similarity:242/479 - (50%) Gaps:43/479 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTHKPC--KGP-----RLGVRHLQSFLLFLGLTVMHIARLNVSVAIVAM---------TNAATTN 49
            |..||.  |||     |.|:..:..|..|..:|    .|:::|:||:||         :||:|..
Human     1 MDGKPATRKGPDFCSLRYGLALIMHFSNFTMIT----QRVSLSIAIIAMVNTTQQQGLSNASTEG 61

  Fly    50 P----------NFPEF-------EWTEKQKSYILSSFYWGYILTLFPGSFLCRRYGAKVVLFVAS 97
            |          :..||       :|:.:.:..|.||..:|.||||.|..:|...:|||.:|....
Human    62 PVADAFNNSSISIKEFDTKASVYQWSPETQGIIFSSINYGIILTLIPSGYLAGIFGAKKMLGAGL 126

  Fly    98 CGTAVLSLMTPWCITWGGWQVFCAIRILQGLFQGVIFPCVTEHLAMWSPPEERNRLGAFSYTGTD 162
            ..:::|:|.||....:|...|. .:|.:||:.||:.:.......|.|:||.||::|...:.:|:.
Human   127 LISSLLTLFTPLAADFGVILVI-MVRTVQGMAQGMAWTGQFTIWAKWAPPLERSKLTTIAGSGSA 190

  Fly   163 CGTVLAMFISGMIAKGAMGWPGISYVSGSLCAAWCFLWLIFASNNATESRFVGEAECKYIESSLE 227
            .|:.:.:.:.|:|:: |:.||.|.|:.||.....|.||.....::......:...|.::|.|||.
Human   191 FGSFIILCVGGLISQ-ALSWPFIFYIFGSTGCVCCLLWFTVIYDDPMHHPCISVREKEHILSSLA 254

  Fly   228 HNEDFHGRTIPIPWRAIWTSVPFLALLVTRCAETYGLSTLQAEIPSYMNGVLNMEIQSNAVFSSL 292
            ......||.:||  :|:.|.:|..|:.:...:..:..:.:...:|:|::.:|::.|:.:.|.|||
Human   255 QQPSSPGRAVPI--KAMVTCLPLWAIFLGFFSHFWLCTIILTYLPTYISTLLHVNIRDSGVLSSL 317

  Fly   293 PFLAMWLLSYVYLIAADVLLKKKILSLTAVRKLFNTLSFWIPAAALIGIGFLSEENKNLAIVLMT 357
            ||:|....:.:....||.||.:.:|.|..|||||::|...:|:...:.:.|:: .:..:.|:|:.
Human   318 PFIAAASCTILGGQLADFLLSRNLLRLITVRKLFSSLGLLLPSICAVALPFVA-SSYVITIILLI 381

  Fly   358 VSVGVNSGATIGSSLNSIDLSPNHAGILIGLSNTVANVIPILTPLIAGEIVADKHNRGQWQIVFG 422
            :..|.::....|..:|::|::|.:|..|:|:|.....:..|::....|.:::.....| |:.||.
Human   382 LIPGTSNLCDSGFIINTLDIAPRYASFLMGISRGFGLIAGIISSTATGFLISQDFESG-WRNVFF 445

  Fly   423 LAAVIFFVGNVVFIIWGTAKAQPW 446
            |:|.:...|.|.::.:|.|:.|.|
Human   446 LSAAVNMFGLVFYLTFGQAELQDW 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 125/459 (27%)
MFS 19..438 CDD:119392 121/444 (27%)
SLC17A2NP_001273052.1 2A0114euk 1..477 CDD:129972 133/479 (28%)
MFS 81..461 CDD:119392 106/385 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148660
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.