DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9826 and LOC100487792

DIOPT Version :9

Sequence 1:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_031761604.1 Gene:LOC100487792 / 100487792 -ID:- Length:345 Species:Xenopus tropicalis


Alignment Length:348 Identity:71/348 - (20%)
Similarity:126/348 - (36%) Gaps:76/348 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 MGWPGISYVSGSLCAAWCFLWLIFASNNATESRFVGEAECKYIESSLEHNEDFHGRTIPIPWRAI 244
            :.|..|:...|.:|.:...|::...|...||..  .|.:...:|.||     |......:.|   
 Frog     8 LSWIQIAPCLGVICLSLLLLFMKDPSGGNTEEE--DEDDEPQVECSL-----FSCLKPLLTW--- 62

  Fly   245 WTSVPFLALLVTRCAETYGLSTLQAEIPSYMNGVLNMEIQSNAVFSSLPFLAMWLLSYVYLIAAD 309
                .|..:::...:..:....:.|.||.:::...|...:...:|.|..:.:.:::......|||
 Frog    63 ----SFALIMIGSLSVDFIHEGMFAVIPDFLDRTRNETGKQWPLFLSQSYYSDFMVYSAIKCAAD 123

  Fly   310 V-----------LLKKK---------ILSLTAVRKLFNTLSFWI------PAAALIGIGFLSEEN 348
            |           ||.|:         .:.|.|...:|:...|:|      |...|...|.....|
 Frog   124 VLGMLLGMEISKLLSKEPHSAGPWVCAVGLFAFTPIFSLFLFFIKDGIVLPCVFLFISGVFLSLN 188

  Fly   349 KNLAIVLMTVSVGVNSGATIGSSLNSIDLSPNHAGILIGLSNTVANV-IPILTPLIAGEIVADKH 412
            :.|:..:| :||......||...|.:.            |:..:|.| .|.:...|:.:|.....
 Frog   189 QALSEDMM-LSVIRPKFYTIAGQLQAF------------LTRLIAGVGAPFIIEYISVKIQESNS 240

  Fly   413 NRGQWQIVFGLAAVIFFVGNVVFIIWGTAKAQPWDADDFLK-----PKDTESACEKPKITPAEVA 472
            .:..::.:  ..|::|.  .||.:|.||.         ||.     .||.|:|.:......::|.
 Frog   241 EKTSFECM--QFALMFL--TVVAVIGGTC---------FLYLNLSFRKDREAADKNATPRQSDVE 292

  Fly   473 PPIDPVLEQQISWPERYTVKAIE 495
            ..:..| ::.|   |||..:.||
 Frog   293 KSLFKV-QRGI---ERYRGQRIE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 57/296 (19%)
MFS 19..438 CDD:119392 54/284 (19%)
LOC100487792XP_031761604.1 MFS <4..267 CDD:421695 57/298 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D619250at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.