DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9825 and YOL163W

DIOPT Version :9

Sequence 1:NP_611723.3 Gene:CG9825 / 37624 FlyBaseID:FBgn0034783 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_014479.1 Gene:YOL163W / 854001 SGDID:S000005523 Length:169 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:37/150 - (24%)
Similarity:55/150 - (36%) Gaps:46/150 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YDWTEAEKSYILSSFFWGYI-LTQFLGGYLCKRFGVKSVMFWGVF---GSGVCSALTPLFIGFGE 115
            |.::.:|.| |..||||..: |||.          :.|::.:|||   |.|          |...
Yeast    44 YFYSSSELS-IRLSFFWVTLSLTQI----------ITSIVAFGVFHMRGIG----------GMAG 87

  Fly   116 WQAYCGIRVLMGLAQGV-----VFPCIHQHLAKWSPP------EER---NRLGALSHTGIECGNV 166
            ||....|..:..|..|:     :.|.:.|....||..      ||:   |::.....|..:..|.
Yeast    88 WQWLFLIERIFTLVIGISAYFLMVPSVVQTKKPWSKKGWFTEREEKIIVNKILRDDPTKGDMNNR 152

  Fly   167 SAMFLSGMIAKSSLGWPGIS 186
            ..|.|..:       |.||:
Yeast   153 QGMSLKML-------WQGIT 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9825NP_611723.3 2A0114euk 14..450 CDD:129972 37/149 (25%)
MFS 54..438 CDD:119392 37/149 (25%)
YOL163WNP_014479.1 MFS 1..>151 CDD:421695 31/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344229
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.