DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9825 and RPA34

DIOPT Version :9

Sequence 1:NP_611723.3 Gene:CG9825 / 37624 FlyBaseID:FBgn0034783 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_012387.1 Gene:RPA34 / 853293 SGDID:S000003684 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:65 Identity:16/65 - (24%)
Similarity:24/65 - (36%) Gaps:18/65 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 VFGTAETQPWDAEDYLQTQNPELANRPPMQALSF----------------PINENSKEKINSKSH 485
            ||..:||....|.||.:.:.|. .:.|.::.|..                .:.||.||. ..:||
Yeast   136 VFSVSETAKIPAIDYSKVRVPR-KDVPKVEGLKLEHFATGYDAEDFHVAEEVKENKKEP-KKRSH 198

  Fly   486  485
            Yeast   199  198

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG9825NP_611723.3 2A0114euk 14..450 CDD:129972 5/12 (42%)