DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9825 and TCOF1

DIOPT Version :9

Sequence 1:NP_611723.3 Gene:CG9825 / 37624 FlyBaseID:FBgn0034783 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_005268559.1 Gene:TCOF1 / 6949 HGNCID:11654 Length:1526 Species:Homo sapiens


Alignment Length:177 Identity:40/177 - (22%)
Similarity:69/177 - (38%) Gaps:38/177 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 STLQAEIPSYMNGVLDMDM-KSNAFFSALPFLAMWCMSYIYLVVADVLLGKN-------SVSLTI 321
            |.|.|::||.|......:. |:....:::|..|..      ..||::|.||:       |.:.|:
Human   111 SVLGADLPSSMKEKAKAETEKAGKTGNSMPHPATG------KTVANLLSGKSPRKSAEPSANTTL 169

  Fly   322 LRKT--YNSIAFWIPAAT--LVGIGFLDKEQKNFAIALMTISV----GVNSAQTIGSVLNTIDLS 378
            :.:|  ..|:..:..||.  :|..|..|...::.:.:.....|    .|..||...|.::|.:..
Human   170 VSETEEEGSVPAFGAAAKPGMVSAGQADSSSEDTSSSSDETDVEGKPSVKPAQVKASSVSTKESP 234

  Fly   379 KNHASILMGIVNTAANFVPIVTPLVVGWIV---------KENSDRSQ 416
            ...|:...|.|..       |||.|.|..:         :|.|:.|:
Human   235 ARKAAPAPGKVGD-------VTPQVKGGALPPAKRAKKPEEESESSE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9825NP_611723.3 2A0114euk 14..450 CDD:129972 40/177 (23%)
MFS 54..438 CDD:119392 40/177 (23%)
TCOF1XP_005268559.1 LisH 6..37 CDD:128913
Treacle <212..511 CDD:281536 17/70 (24%)
Treacle 316..904 CDD:281536
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11815
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.