DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9825 and Slc17a9

DIOPT Version :9

Sequence 1:NP_611723.3 Gene:CG9825 / 37624 FlyBaseID:FBgn0034783 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_038961483.1 Gene:Slc17a9 / 362287 RGDID:1311940 Length:448 Species:Rattus norvegicus


Alignment Length:324 Identity:75/324 - (23%)
Similarity:132/324 - (40%) Gaps:58/324 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LIFLNITTVFIGRLNVGVSVVAMTNAETTNPNFPEYDWTEAEKSYILSSFFWGYILTQFLGGYLC 84
            ::.|....::..|:.:.|..|||:.         ::.|.:.|...:||||||||.|||.:||:|.
  Rat    40 MLLLGTCLLYCTRVTMPVCTVAMSQ---------DFGWNKKEAGIVLSSFFWGYCLTQVVGGHLG 95

  Fly    85 KRFGVKSVMFWGVFGSGVCSALTPLF--IGFGEWQAYCGIRVLMGLAQGVVFPCIHQHLAKWSPP 147
            .|.|.:.|:.......|..:..|||.  :|.|........|:|.||.|||.||.:...|::....
  Rat    96 DRIGGEKVILLSASAWGFITVTTPLLAHLGSGHLAFVTFSRILTGLLQGVYFPALTSLLSQRVQE 160

  Fly   148 EER----NRLGALSHTG-IECGNVSAMFLSGMIAKSSLGWPGISYVSAGVAFFWCTLWFVFAANH 207
            .||    :.:||.|..| :..|.:.::.|      ...||..:.|.|.|:...|  :::|:    
  Rat   161 SERSFTYSTVGAGSQVGTLVTGGIGSVLL------DRCGWQSVFYFSGGLTLLW--VYYVY---- 213

  Fly   208 PTESRFIGENELIYIESSLKHNESYHATIIP------IPWKAIWTSAPFLALLIVRCAENWGLST 266
               ...:.|.:|:.....|       |..:|      :||:.::..|...|::..:.:.......
  Rat   214 ---KYLLDEKDLVLALGVL-------AQGLPVTRPSKVPWRQLFRKASVWAVICSQLSSACSFFI 268

  Fly   267 LQAEIPSYMNGVLDMDMKSNAFFSALPFLAMWCMSYI-YLVVADVLLGKNSVSLTILRKTYNSI 329
            |.:.:|::             |....|....|..:.: :|:.....|....:|..::.:.|..|
  Rat   269 LLSWLPTF-------------FKETFPHSKGWVFNVVPWLLAIPASLFSGFISDRLISQGYRVI 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9825NP_611723.3 2A0114euk 14..450 CDD:129972 75/324 (23%)
MFS 54..438 CDD:119392 69/290 (24%)
Slc17a9XP_038961483.1 MFS 38..>326 CDD:421695 75/324 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.