DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9825 and SPAC1B3.15c

DIOPT Version :9

Sequence 1:NP_611723.3 Gene:CG9825 / 37624 FlyBaseID:FBgn0034783 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_594800.1 Gene:SPAC1B3.15c / 2542116 PomBaseID:SPAC1B3.15c Length:628 Species:Schizosaccharomyces pombe


Alignment Length:359 Identity:78/359 - (21%)
Similarity:129/359 - (35%) Gaps:125/359 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 GVCSALTPLFIGFGEWQAYCGIRVLMGLAQGVVFPCI---------HQHLAKWSPPEERNRLGAL 156
            |.|.|:  |.........:..:|...|||...::|..         .|||.|        |:| .
pombe   243 GACHAV--LGTKGSSASGFIALRFFNGLAIAGMWPGFAFYTSRFYRDQHLGK--------RIG-W 296

  Fly   157 SHTGIECGNVSAMFLSGMIAKSSLGWPGISYVSAGVAFFWCTL-WFVFAANHPTESRFIGENELI 220
            .:|..:..:|:...||....|.. |..|:      ..:.|..| |.|.|.   |:..|: ...|.
pombe   297 YYTAAQISSVATSLLSAAFQKMD-GLHGL------YGYQWMFLIWGVVAF---TQGLFL-PRWLP 350

  Fly   221 YIESSLKHNESYHATIIPIPWKAIWTSAPFLALLIVRCAENWGLSTLQAEIPSYMNGVLDMDMKS 285
            .|:.: :|||.:      |.|..|   ..||..|  :.:||.||:..:.|:.:            
pombe   351 CIKHN-QHNEKW------ISWIRI---PKFLGFL--KASENTGLTPEEEEVHA------------ 391

  Fly   286 NAFFSALPFLAMWCMSYIYLVVADVLLGKNSVSLTILRKTYNSIAFWIPAATLVGIGFLDKEQKN 350
                             ||:  |::.:|| |.:||.|...:..:..|.|.....|:         
pombe   392 -----------------IYM--AEMQVGK-SWTLTDLADAFLDVRLWPPIFMFFGV--------- 427

  Fly   351 FAIALMTISVGVNSAQTIGSVLNTIDLSKNHASILMGIVNTAANFVPIVTPLVVG--WI------ 407
                     ||:::    |.|        |::|:::..:|  .||..:...|:|.  |:      
pombe   428 ---------VGISN----GLV--------NYSSLIISEIN--ENFSSVTVSLLVAPIWVFDAIAI 469

  Fly   408 --VKENSDRSQWQIVFIIASVIFFVGNCIYLVFG 439
              |....||..       ..::||||:|::::.|
pombe   470 LTVLPLHDRFH-------KKMLFFVGSCLFVLAG 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9825NP_611723.3 2A0114euk 14..450 CDD:129972 78/359 (22%)
MFS 54..438 CDD:119392 77/356 (22%)
SPAC1B3.15cNP_594800.1 MFS 158..600 CDD:119392 78/359 (22%)
2A0114 190..600 CDD:273326 78/359 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.