DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9825 and SLC37A4

DIOPT Version :9

Sequence 1:NP_611723.3 Gene:CG9825 / 37624 FlyBaseID:FBgn0034783 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001157750.1 Gene:SLC37A4 / 2542 HGNCID:4061 Length:451 Species:Homo sapiens


Alignment Length:427 Identity:95/427 - (22%)
Similarity:158/427 - (37%) Gaps:81/427 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YILSSFFWGYILTQFLGGYLCKRFGVKSVMFWGVFGSGVCSALTPLFIG----FGEWQA----YC 120
            :|.||....|.:::|:.|.|..:...:    | :|.||:      |.:|    |..|.:    :.
Human    51 FITSSQSAAYAISKFVSGVLSDQMSAR----W-LFSSGL------LLVGLVNIFFAWSSTVPVFA 104

  Fly   121 GIRVLMGLAQGVVFPCIHQHLAKWSPPEERNRLGALSHTGIECGNVSAMFLSGMIAKSSLGWPGI 185
            .:..|.|||||:.:|...:.|.||..|.:.....|:..|.:.........|:.::|: |..|...
Human   105 ALWFLNGLAQGLGWPPCGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILATILAQ-SYSWRST 168

  Fly   186 SYVSAGVAFFWCTLWFVFAANHPTESRFIGENELIYIES-----SLKHNESYHATIIPIPWKAIW 245
            ..:|..:......|..:...|.|.:   :|...|..:.|     ||| .||....::..|:  :|
Human   169 LALSGALCVVVSFLCLLLIHNEPAD---VGLRNLDPMPSEGKKGSLK-EESTLQELLLSPY--LW 227

  Fly   246 T-SAPFLALLIVR-CAENWG-LSTLQAEIPSYMNGVLDMDMKSNAFFSALPF------LAMWCMS 301
            . |..:|.:..|: |..:|| ...:|.:..|.:.|        :::.|||..      :|...:|
Human   228 VLSTGYLVVFGVKTCCTDWGQFFLIQEKGQSALVG--------SSYMSALEVGGLVGSIAAGYLS 284

  Fly   302 YIYLVVADV-------------LLGKNSVSLTILRKTYNS-----IAFWI----PAATLVGIGFL 344
            ...:..|.:             ::...:||:.:.|.|..|     :|||.    |.|.|.  ||.
Human   285 DRAMAKAGLSNYGNPRHGLLLFMMAGMTVSMYLFRVTVTSDSPKDVAFWTLALHPLAELT--GFT 347

  Fly   345 DKEQKNFAIALMTISVGVNSAQTIG--SVLNTIDLSKNHASILMGIVNTAANFVPIVTPLVVGWI 407
            :.|   ..|.::....|.:|...|.  .|:.......|.......||...||....:..|....|
Human   348 EHE---LWILVLGAVFGFSSYGPIALFGVIANESAPPNLCGTSHAIVGLMANVGGFLAGLPFSTI 409

  Fly   408 VKENSDRSQWQIVFIIASVIFFVGNCIYLVFGTAETQ 444
            .|..|    |...|.:|.||.......:.:.....|:
Human   410 AKHYS----WSTAFWVAEVICAASTAAFFLLRNIRTK 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9825NP_611723.3 2A0114euk 14..450 CDD:129972 95/427 (22%)
MFS 54..438 CDD:119392 94/419 (22%)
SLC37A4NP_001157750.1 MFS 14..437 CDD:119392 94/420 (22%)
2A0104 18..419 CDD:273319 90/402 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.