DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9825 and Slc17a1

DIOPT Version :9

Sequence 1:NP_611723.3 Gene:CG9825 / 37624 FlyBaseID:FBgn0034783 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_598238.2 Gene:Slc17a1 / 171080 RGDID:620099 Length:465 Species:Rattus norvegicus


Alignment Length:458 Identity:125/458 - (27%)
Similarity:216/458 - (47%) Gaps:48/458 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLIFLNITTVFIGRLNVGVSVVAMTNAETTNPNF--------------PEYDWTEAEKSYILSSF 69
            ||.|.|| .:...|:.:.:::|||.| :|..|:.              |.:.|:...:..||||.
  Rat    23 LLHFCNI-VIMAQRVCLNLTMVAMVN-KTEPPHLSNKSVAEMLDNVKNPVHSWSLDIQGLILSSV 85

  Fly    70 FWGYILTQFLGGYLCKRFGVKSVMFWGVFGSGVCSALTPLFIGFG-EWQAYCGIRVLMGLAQGVV 133
            |.|.::.|...|||...:.:|.::...:|.|.|.|.|.|.....| .....|  |||.|:|||.|
  Rat    86 FLGMVVIQVPVGYLSGAYPMKKIIGSSLFLSSVLSLLIPPAAQVGAALVIVC--RVLQGIAQGAV 148

  Fly   134 FPCIHQHLAKWSPPEERNRLGALSHTGIECGNVSAMFLSGMIAKSSLGWPGISY----VSAGVAF 194
            ....|....||:||.||.||.:::.:|...|...|:.:||.|. ..||||.:.|    |...::.
  Rat   149 STGQHGIWVKWAPPLERGRLTSMTLSGFVMGPFIALLVSGFIC-DLLGWPMVFYIFGIVGCVLSL 212

  Fly   195 FWCTLWFVFAANHPTESRFIGENELIYIESSLKHNESYHATIIPIPWKAIWTSAPFLALLIVRCA 259
            ||..|:|....|||    ::..:|..||.|||.  :..|:....:|.||:..|.|..|:::...|
  Rat   213 FWFILFFDDPNNHP----YMSSSEKDYITSSLM--QQVHSGRQSLPIKAMLKSLPLWAIILNSFA 271

  Fly   260 ENWGLSTLQAEIPSYMNGVLDMDMKSNAFFSALPFLAMWCMSYIYLVVA----DVLLGKNSVSLT 320
            ..|..:.|....|::::..|.::::.|...|:||:|    ::||..:||    |.||.:...|:.
  Rat   272 FIWSNNLLVTYTPTFISTTLHVNVRENGLLSSLPYL----LAYICGIVAGQMSDFLLSRKIFSVV 332

  Fly   321 ILRKTYNSIAFWIPAATLVGIGFLDKEQKNF--AIALMTISVGVNSAQTIGSVLNTIDLSKNHAS 383
            .:||.:.::..:.|...:|.:.:|   ..||  .:..:|::....|....|.::|.:|::..:..
  Rat   333 AVRKLFTTLGIFCPVIFVVCLLYL---SYNFYSTVIFLTLANSTLSFSFCGQLINALDIAPRYYG 394

  Fly   384 ILMGIVNTAANFVPIVTPLVVGWIVKENSDRSQWQIVFIIASVIFFVGNCI--YLVFGTAETQPW 446
            .|..:......|..:::..:.|.|:.::.:.:..:..|::|.:..   .|:  ||:|...:.|.|
  Rat   395 FLKAVTALIGIFGGLISSTLAGLILNQDPEYAWHKNFFLMAGINV---TCLAFYLLFAKGDIQDW 456

  Fly   447 DAE 449
            ..|
  Rat   457 AKE 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9825NP_611723.3 2A0114euk 14..450 CDD:129972 125/458 (27%)
MFS 54..438 CDD:119392 108/396 (27%)
Slc17a1NP_598238.2 2A0114euk 1..464 CDD:129972 125/458 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.