DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9825 and Slc17a7

DIOPT Version :9

Sequence 1:NP_611723.3 Gene:CG9825 / 37624 FlyBaseID:FBgn0034783 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_038966881.1 Gene:Slc17a7 / 116638 RGDID:620101 Length:585 Species:Rattus norvegicus


Alignment Length:529 Identity:155/529 - (29%)
Similarity:237/529 - (44%) Gaps:76/529 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAETNKGPV-------LGMRHVQALLIFLNITTVFIGRLNVGVSVVAMTNAETTN--------- 49
            :|..|...||       |..|::.|::..|.....|..|.|:||::|:|.|..||:         
  Rat    42 VTTHTRDPPVVDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQT 106

  Fly    50 ------------PNF----------PEYDWTEAEKSYILSSFFWGYILTQFLGGYLCKRFGVKSV 92
                        |..          .:::|.......|..|||||||:||..||::|::|....|
  Rat   107 PYRSVHKQEAVTPTVGDIQGGDTEKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRV 171

  Fly    93 MFWGVFGSGVCSALTP--LFIGFGEWQAYCGI--RVLMGLAQGVVFPCIHQHLAKWSPPEERNRL 153
            ..:.:..:...:.|.|  ..:.:|     |.|  |:|.||.:||.:|..|...:||:||.||:||
  Rat   172 FGFAIVATSTLNMLIPSAARVHYG-----CVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRL 231

  Fly   154 GALSHTGIECGNVSAMFLSGMIAKSSLGWPGISYVSAGVAFFWCTLWFVFAANHPTESRFIGENE 218
            ...:..|...|.|.||.|:|::.:.| ||..:.||......||...|.:.:...|.....|.|.|
  Rat   232 ATTAFCGSYAGAVVAMPLAGVLVQYS-GWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEE 295

  Fly   219 LIYIESSLKHNESY--HATIIPIPWKAIWTSAPFLALLIVRCAENWGLSTLQAEIPSYMNGVLDM 281
            ..|||.::..:...  ..|....||:..:||.|..|:::.....:|....|....|:|...|...
  Rat   296 RKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGF 360

  Fly   282 DMKSNAFFSALPFLAMWCMSYIYLVVADVLLGKNSVSLTILRKTYNSIAFWIPAATLVGIGFLDK 346
            ::......||||.|.|..:..|...:||.|..::.:|.|.:||..|...|.:.|..|:.:|:  .
  Rat   361 EISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGY--S 423

  Fly   347 EQKNFAIALMTISVGVNSAQTIGSVLNTIDLSKNHASILMGIVNTAANFVPIVTPLVVGWIVKEN 411
            ..|..||:.:.::||.:.....|..:|.:|::..:|||||||.|.......:|.|::||.:.|..
  Rat   424 HSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHK 488

  Fly   412 SDRSQWQIVFIIASVIFFVGNCIYLVFGTAETQPWDAEDYLQTQNPELANRPPMQALSFPINENS 476
            : |.:||.||:|||::.:.|...|.||.:.|.||| ||       ||               |.|
  Rat   489 T-REEWQYVFLIASLVHYGGVIFYGVFASGEKQPW-AE-------PE---------------EMS 529

  Fly   477 KEKINSKSH 485
            :||.....|
  Rat   530 EEKCGFVGH 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9825NP_611723.3 2A0114euk 14..450 CDD:129972 142/472 (30%)
MFS 54..438 CDD:119392 121/389 (31%)
Slc17a7XP_038966881.1 MFS_SLC17A6_7_8_VGluT 66..515 CDD:340940 135/457 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342472
Domainoid 1 1.000 47 1.000 Domainoid score I11657
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.