DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9825 and SLC17A4

DIOPT Version :9

Sequence 1:NP_611723.3 Gene:CG9825 / 37624 FlyBaseID:FBgn0034783 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_005486.1 Gene:SLC17A4 / 10050 HGNCID:10932 Length:497 Species:Homo sapiens


Alignment Length:479 Identity:124/479 - (25%)
Similarity:229/479 - (47%) Gaps:46/479 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ETNKGPVLGMRHVQALLIFLNITTVFIGRLNVGVSVVAMT---------NAETTNPN-------- 51
            |.::.....:||..||::.|...:::..::|:.:::.||.         ||.|..|:        
Human    26 ECSRKGFCSVRHGLALILQLCNFSIYTQQMNLSIAIPAMVNNTAPPSQPNASTERPSTDSQGYWN 90

  Fly    52 ---------FPEYDWTEAEKSYILSSFFWGYILTQFLGGYLCKRFGVKSVMFWGVFGSGVCSALT 107
                     .|.|||:...:..||||..:|..|.....||:...||.|.|:..|:|.|...:...
Human    91 ETLKEFKAMAPAYDWSPEIQGIILSSLNYGSFLAPIPSGYVAGIFGAKYVVGAGLFISSFLTLFI 155

  Fly   108 PLFIGFGEWQAYCGI------RVLMGLAQGVVFPCIHQHLAKWSPPEERNRLGALSHTGIECGNV 166
            ||       .|..|:      |::.|:||.:|....:....||:||.||::|..::.:|...|:.
Human   156 PL-------AANAGVALLIVLRIVQGIAQVMVLTGQYSIWVKWAPPLERSQLTTIAGSGSMLGSF 213

  Fly   167 SAMFLSGMIAKSSLGWPGISYVSAGVAFFWCTLWFVFAANHPTESRFIGENELIYIESSLKHNES 231
            ..:...|::.: ::|||.:.|:..|:....|.|||....:.|....||...|..||..||...:.
Human   214 IVLLAGGLLCQ-TIGWPYVFYIFGGIGCACCPLWFPLIYDDPVNHPFISAGEKRYIVCSLAQQDC 277

  Fly   232 YHATIIPIPWKAIWTSAPFLALLIVRCAENWGLSTLQAEIPSYMNGVLDMDMKSNAFFSALPFLA 296
            .....:||  :|:..|.|..|:|:....|.|...|:.|..|:|::.||..:::.:...|||||: 
Human   278 SPGWSLPI--RAMIKSLPLWAILVSYFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFV- 339

  Fly   297 MWCMSYIY-LVVADVLLGKNSVSLTILRKTYNSIAFWIPAATLVGIGFLDKEQKNFAIALMTISV 360
            :.|:..|. .::||.||.:..:.|..:||.:.:|....|:..||.:.:: :...:..:..:.:|.
Human   340 VGCICIILGGLLADFLLSRKILRLITIRKLFTAIGVLFPSVILVSLPWV-RSSHSMTMTFLVLSS 403

  Fly   361 GVNSAQTIGSVLNTIDLSKNHASILMGIVNTAANFVPIVTPLVVGWIVKENSDRSQWQIVFIIAS 425
            .::|....|:::|.:|::..:...|.|::...|:....::|...|:.:.::|:.. |:.||::::
Human   404 AISSFCESGALVNFLDIAPRYTGFLKGLLQVFAHIAGAISPTAAGFFISQDSEFG-WRNVFLLSA 467

  Fly   426 VIFFVGNCIYLVFGTAETQPWDAE 449
            .:...|...||:||.|:.|.|..|
Human   468 AVNISGLVFYLIFGRADVQDWAKE 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9825NP_611723.3 2A0114euk 14..450 CDD:129972 123/469 (26%)
MFS 54..438 CDD:119392 104/390 (27%)
SLC17A4NP_005486.1 UhpC 30..491 CDD:332119 122/473 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148631
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.