DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12490 and YOL162W

DIOPT Version :9

Sequence 1:NP_611722.2 Gene:CG12490 / 37623 FlyBaseID:FBgn0034782 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_014480.1 Gene:YOL162W / 854002 SGDID:S000005522 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:231 Identity:46/231 - (19%)
Similarity:80/231 - (34%) Gaps:71/231 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 LALTLTRCCATWGLSTLQAQIPTYMNGVLDMDMKSNAFFSALPFLAMWIMSYVYLIIADVLLAGN 315
            ||..||....:.|.:|.||.:....|.||.:         .|.|...|          ......|
Yeast    12 LATYLTLVLRSIGFTTFQANLLAIPNFVLHI---------LLLFGLTW----------STEKCNN 57

  Fly   316 RLSLTALRKTFN-----SLAFW----------IPCATLIGIGFLDQEQKNLAIALMTISVGVNSG 365
            ||.|:.|:..:.     .|.||          ....|||    ||    |..|..:.:|:     
Yeast    58 RLGLSLLQPLYTVPLLAVLRFWKGTMFNKWGTYAIITLI----LD----NPYIHAICVSL----- 109

  Fly   366 ATIGSSLNTIDLSPNHASILMGILNTAVTVVPIVTPLIVGVIVHEDDNRAEWQ----IVFIIAAV 426
                       .|.|..|:....::|.:..:.:...||:...::...:...::    ::|.:|..
Yeast   110 -----------CSRNSQSVKTRTVSTCLYNMFVQAGLIISSNIYAKSDAPLYRKGNGVLFGLALF 163

  Fly   427 LF--FVGNS-VYLYFGTAVSQPWDA------EDYLT 453
            :|  .:|:. :|:|......:.|:|      :.||:
Yeast   164 MFPILIGSKLIYVYINKQRDKRWNAMSEEEKDHYLS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12490NP_611722.2 2A0114euk 14..450 CDD:129972 44/226 (19%)
MFS 54..438 CDD:119392 41/208 (20%)
YOL162WNP_014480.1 MFS <1..169 CDD:421695 39/199 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344232
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.