DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12490 and liz1

DIOPT Version :9

Sequence 1:NP_611722.2 Gene:CG12490 / 37623 FlyBaseID:FBgn0034782 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001342731.1 Gene:liz1 / 2540342 PomBaseID:SPBC2G2.01c Length:514 Species:Schizosaccharomyces pombe


Alignment Length:168 Identity:41/168 - (24%)
Similarity:70/168 - (41%) Gaps:31/168 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 FFWGYILTQFIGGYLCKR------FGVKSVMFWG---VFVSGVCSALTPLFIGFGGWQAYCGIRV 124
            |..|||:.|..|.|..:|      |.|.::: ||   :|...|.|.           :|...:|.
pombe    76 FTCGYIIGQLPGSYALQRVPARLWFSVMNIL-WGLMTIFSFAVHSV-----------RALMILRF 128

  Fly   125 VMGLAQGLVFPCIHHHLAKWSPPAER-NRLGALSHTGMECGNVSAMFLSGMIAKSAIGWPGIS-- 186
            .|.:|:...|...|:.|..|...:|. .|.|..|.:|: .|.:.|.:|...:..|..|..|:|  
pombe   129 FMAVAEASTFAGTHYILGAWYKESELCKRAGIFSASGL-VGTMFAGYLQTAVHSSLNGKGGLSGW 192

  Fly   187 ---YVSAGLAFAWCAIWFVFAADNAVESR---YITQEE 218
               ::..|:.....:::.:|...:..|:.   |.|::|
pombe   193 RWLFIIDGILTIPLSLYGLFLFPDVPETTKAPYFTEQE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12490NP_611722.2 2A0114euk 14..450 CDD:129972 41/168 (24%)
MFS 54..438 CDD:119392 41/168 (24%)
liz1NP_001342731.1 MFS_1 37..401 CDD:311564 41/168 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2672
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.