DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12490 and F44E7.7

DIOPT Version :9

Sequence 1:NP_611722.2 Gene:CG12490 / 37623 FlyBaseID:FBgn0034782 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_504517.2 Gene:F44E7.7 / 185739 WormBaseID:WBGene00018429 Length:455 Species:Caenorhabditis elegans


Alignment Length:478 Identity:106/478 - (22%)
Similarity:206/478 - (43%) Gaps:54/478 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAETNKGPVLGMRHVQA---------LLIFLNITTVFIGRLN---VGVSVVAMTN--AETTNPN 51
            ||..|.:.....:||:.:         |::.|::..:.:|::|   ...:|:.|.:  .:..:.|
 Worm     1 MTVITIESGFPDVRHISSFVFFHKTRYLIMILSLLCMTVGQMNSLSFNFTVICMEDVVVDFHSNN 65

  Fly    52 FPEYDWTE--AEKSYIFSSFFWGYILTQFIGGYLCKRFGVK-SVMFWGVFVSGVCSALTPLFIGF 113
            ..:..|.|  ::||:|||....|.::.......:....|:: :...:|: :|...|.|.||.:..
 Worm    66 RTDLHWLEDPSQKSWIFSGVAIGAVIGLLPLVPMLDNIGLRITFTLFGI-ISAASSLLFPLSVHM 129

  Fly   114 GGWQAYCGIRVVMGLAQGLVFPCIHHHLAKWSPPAERNRLGALSHTGMECGNVSAMFLSGMIAKS 178
            |.:..:. :|::.|:...:::..:.:....|:|..|.....|:...|.:..|:..|.:||::.:|
 Worm   130 GFYAVFI-VRILQGIGTSILYTVVAYIPGIWAPKTEMGTFLAVLSCGFQLSNIICMPVSGILCES 193

  Fly   179 AIGWPGISYVSAGLAFAWCAIWFVFAADNAVESRYITQEELHYI--ESSLKHNEDYHKTVIPVPW 241
            ..||..|.|:...|......::|...||......:::.:||..|  |...|..::      .||:
 Worm   194 DWGWRPIYYIFGSLTILVYMVFFFLYADAPKNHFHVSSKELSMICAEKKPKKGKE------SVPY 252

  Fly   242 MAIWTSAPFLALTLTRCCATWGLSTLQAQIPTYMNGVLDMDMKSNAFFSALPFLAMWIMSYVYLI 306
            .||......||..|:.|........|....|||:..||..|:|...:.:||||::..|:.:....
 Worm   253 RAICFDKCVLATWLSMCGRNVAFYVLVLYGPTYLREVLHFDVKGTGWAAALPFVSCAIVKFASGQ 317

  Fly   307 IADVLLAGNRLSLTALRKTFNSLAFWIPCA--TLIGI--GFLDQ---EQKNLAIALMTISVGVNS 364
            :.|      ||::      |:....::.|.  ::||:  ||:..   ..:.:|....|.:|.: |
 Worm   318 LTD------RLTM------FSEKTKFVTCTLISMIGLAAGFVVMSLTSSRTIAQISYTFAVTL-S 369

  Fly   365 GATIGSSLNTIDL-SPNHASILMGILNTAVTVVPIVTPLIVGVIVHEDDNRAEWQIVFIIAAVLF 428
            |.||..::..:.| ...|......::.....:...:.||.||.:. .::...||..:|.|.:.:.
 Worm   370 GITIMGTVKCLQLRCQQHVHFATVVVAFMACIWQFLVPLGVGYLC-PNNTPEEWSFLFFIVSGIV 433

  Fly   429 FVGNSVYLYFGTAVSQPWDAEDY 451
            .:.|..:.:..||     :|.||
 Worm   434 LIVNIPFPFLTTA-----EAADY 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12490NP_611722.2 2A0114euk 14..450 CDD:129972 101/462 (22%)
MFS 54..438 CDD:119392 89/396 (22%)
F44E7.7NP_504517.2 MFS 31..440 CDD:391944 95/430 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.