DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12490 and LOC100487792

DIOPT Version :9

Sequence 1:NP_611722.2 Gene:CG12490 / 37623 FlyBaseID:FBgn0034782 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_031761604.1 Gene:LOC100487792 / 100487792 -ID:- Length:345 Species:Xenopus tropicalis


Alignment Length:289 Identity:64/289 - (22%)
Similarity:101/289 - (34%) Gaps:95/289 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 PFLALTLTRC---CATWGLSTLQAQIPTYMNGVLDMDMKSNAFFSALP-FL--------AMWIM- 300
            |.:..:|..|   ..||..:.:       |.|.|.:|......|:.:| ||        ..|.: 
 Frog    46 PQVECSLFSCLKPLLTWSFALI-------MIGSLSVDFIHEGMFAVIPDFLDRTRNETGKQWPLF 103

  Fly   301 ---SY-----VYLII---ADVL--LAGNRLS------------------LTALRKTFNSLAFWI- 333
               ||     ||..|   ||||  |.|..:|                  |.|....|:...|:| 
 Frog   104 LSQSYYSDFMVYSAIKCAADVLGMLLGMEISKLLSKEPHSAGPWVCAVGLFAFTPIFSLFLFFIK 168

  Fly   334 -----PCATLIGIG-FLDQEQKNLAIAL---MTISVGVNSGATIGSSLNTIDLSPNHASILMGIL 389
                 ||..|...| ||...|     ||   |.:||                :.|...:| .|.|
 Frog   169 DGIVLPCVFLFISGVFLSLNQ-----ALSEDMMLSV----------------IRPKFYTI-AGQL 211

  Fly   390 NTAVT--VVPIVTPLIVGVI-VHEDDNRAE------WQIVFIIAAVLFFVGNSVYLYFGTAVSQP 445
            ...:|  :..:..|.|:..| |...::.:|      .|...:...|:..:|.:.:||...:..:.
 Frog   212 QAFLTRLIAGVGAPFIIEYISVKIQESNSEKTSFECMQFALMFLTVVAVIGGTCFLYLNLSFRKD 276

  Fly   446 WDAED-YLTVKVPELAKVPAIHEAGKGID 473
            .:|.| ..|.:..::.|  ::.:..:||:
 Frog   277 REAADKNATPRQSDVEK--SLFKVQRGIE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12490NP_611722.2 2A0114euk 14..450 CDD:129972 59/263 (22%)
MFS 54..438 CDD:119392 57/251 (23%)
LOC100487792XP_031761604.1 MFS <4..267 CDD:421695 56/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D619250at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.