DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30265 and PHT4;5

DIOPT Version :9

Sequence 1:NP_001286747.1 Gene:CG30265 / 37622 FlyBaseID:FBgn0050265 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001330368.1 Gene:PHT4;5 / 832160 AraportID:AT5G20380 Length:569 Species:Arabidopsis thaliana


Alignment Length:441 Identity:121/441 - (27%)
Similarity:212/441 - (48%) Gaps:37/441 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TLLLFFNITCLYIGRLNVGVAVVAMTNAESTNPDFPEYDWTLTQKSYILSSFFWGYIITQFLGGY 82
            |.|.|  :.| .:.::|:.:|::.|::         ::.|:.:....:.|||||||.::|..||:
plant   157 TSLAF--VIC-NMDKVNLSIAIIPMSH---------QFGWSSSVAGLVQSSFFWGYALSQLPGGW 209

  Fly    83 LCKRYGVKSVMLWGSFASGIFSALTPLFIGFGEWQAYCGIRVLMGFAQGLIFPCIHQHLARWSPP 147
            |.|.:|.:.|:..|.|.....:||.||..||.....:.  |:|:|..:|:........:||..|.
plant   210 LSKIFGGRKVLEIGVFTWSFATALVPLLAGFMPGLIFS--RILVGIGEGVSPSAATDLIARTIPV 272

  Fly   148 AERNRLGALSHTGIECGNVCAMFFSGMIAKSAIGWPGISYVSAGLALAW-CAFWFVFAADNAEES 211
            .||:|.......|:..|:|..:..:..|.:: ..|..:.|:...|.:.| ..|.|:    |.||.
plant   273 KERSRAVGFVFGGLSLGSVMGLLLAPPIIET-FNWESVFYLFGLLGVGWFVGFQFL----NEEEV 332

  Fly   212 RYITQE--ELHYIESSLKHNEDYHKTVIPVPWMAIWTSAPFFALMVARCCETWGLSTLQAQIPTY 274
            .|...|  ..|..|::.|  |:...::..:||.:.:.|...:|::....|.:||..|..:.:|||
plant   333 SYKGNEISTSHKSENATK--EELGSSLKEIPWKSFFQSPAVWAMIYTHFCGSWGHYTCLSWLPTY 395

  Fly   275 MNGVLDMDMKSNAFFSALPFLAMWIMSYVYLIIADVLLAGNRLSLTALRKIFNSLAFWIP--CAT 337
            .:..|.:::...|:.|.||.||..:::.:....||.|:. |.:..|.:|||..::||..|  |.|
plant   396 FSEALSLNLTEAAWVSILPPLASIVVTSLASQFADYLIT-NGVDTTTVRKICQTIAFVAPAICMT 459

  Fly   338 L--IGIGFLDQEQKNLAIALMTISVGVNSGATIGSSLNTIDLSPNHASILMGIVNTAANVVPIVT 400
            |  :.||....|    .:.::|..:.::|.|..|......|:||.:||||:||.||...|..||.
plant   460 LSSVDIGLPPWE----IVGILTAGLALSSFALSGLYCTHQDISPEYASILLGITNTVGAVPGIVG 520

  Fly   401 PLAVGLIVHEDKNREEWQIVFIIAAVIFFI-GNCVFLYYGTAVSQPWDAED 450
            ....|.::   .:...|.:...:.::.|:: |..|:|.:.::..|.:..||
plant   521 VALTGFLL---DSTHSWTMSLFVPSIFFYLTGTVVWLAFASSEPQTFRKED 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30265NP_001286747.1 2A0114euk 14..450 CDD:129972 119/439 (27%)
MFS 18..438 CDD:119392 118/427 (28%)
PHT4;5NP_001330368.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11662
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.