DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30265 and SPAC1B3.15c

DIOPT Version :9

Sequence 1:NP_001286747.1 Gene:CG30265 / 37622 FlyBaseID:FBgn0050265 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_594800.1 Gene:SPAC1B3.15c / 2542116 PomBaseID:SPAC1B3.15c Length:628 Species:Schizosaccharomyces pombe


Alignment Length:343 Identity:60/343 - (17%)
Similarity:109/343 - (31%) Gaps:153/343 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 GNVCAMFFSGMIAKSAIG--WPGISYVSA--------GLALAWCAFWFVFAADNAEESRYITQEE 218
            |.:...||:|:    ||.  |||.::.::        |..:.|                |.|..:
pombe   258 GFIALRFFNGL----AIAGMWPGFAFYTSRFYRDQHLGKRIGW----------------YYTAAQ 302

  Fly   219 LHYIESSL------------------------------------------KHNEDYHKTVIPVPW 241
            :..:.:||                                          |||:...|      |
pombe   303 ISSVATSLLSAAFQKMDGLHGLYGYQWMFLIWGVVAFTQGLFLPRWLPCIKHNQHNEK------W 361

  Fly   242 MAIWTSAPFFALMVARCCETWGLSTLQAQIPTYMNGVLDMDMKSNAFFSALPFLAMWIMSYVYLI 306
            :: |...|.| |...:..|..||:..:.:                                |:.|
pombe   362 IS-WIRIPKF-LGFLKASENTGLTPEEEE--------------------------------VHAI 392

  Fly   307 IADVLLAGNRLSLTALRKIFNSLAFWIPCATLIGIGFLDQEQKNLAIALMTISVGVNSGATIGSS 371
            ....:..|...:||.|...|..:..|.|.....|:                  ||:::|....||
pombe   393 YMAEMQVGKSWTLTDLADAFLDVRLWPPIFMFFGV------------------VGISNGLVNYSS 439

  Fly   372 LNTIDLSPNHASILMGIVNTAANVVPIVTPLAVGLI----VHEDKNREEWQIVFIIAAVIFFIGN 432
            |...:::.|.:|:.:.::     |.||....|:.::    :|:..:::          ::||:|:
pombe   440 LIISEINENFSSVTVSLL-----VAPIWVFDAIAILTVLPLHDRFHKK----------MLFFVGS 489

  Fly   433 CVFLYYG----TAVSQPW 446
            |:|:..|    |.||..|
pombe   490 CLFVLAGLLITTFVSNVW 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30265NP_001286747.1 2A0114euk 14..450 CDD:129972 60/343 (17%)
MFS 18..438 CDD:119392 55/329 (17%)
SPAC1B3.15cNP_594800.1 MFS 158..600 CDD:119392 60/343 (17%)
2A0114 190..600 CDD:273326 60/343 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.