DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30265 and SLC37A4

DIOPT Version :9

Sequence 1:NP_001286747.1 Gene:CG30265 / 37622 FlyBaseID:FBgn0050265 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001157750.1 Gene:SLC37A4 / 2542 HGNCID:4061 Length:451 Species:Homo sapiens


Alignment Length:424 Identity:92/424 - (21%)
Similarity:149/424 - (35%) Gaps:93/424 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YILSSFFWGYIITQFLGGYLCKRYGVKSVMLWGSFASGIFSALTPLFIG----FGEWQA----YC 120
            :|.||....|.|::|:.|.|..:...:    | .|:||:      |.:|    |..|.:    :.
Human    51 FITSSQSAAYAISKFVSGVLSDQMSAR----W-LFSSGL------LLVGLVNIFFAWSSTVPVFA 104

  Fly   121 GIRVLMGFAQGLIFPCIHQHLARWSPPAERNRLGALSHTGIECGNVCAMFFSGMIAKSAIGWPGI 185
            .:..|.|.||||.:|...:.|.:|..|::.....|:..|.:..........:.::|:| ..|...
Human   105 ALWFLNGLAQGLGWPPCGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILATILAQS-YSWRST 168

  Fly   186 SYVSAGLALAWCAFWFVFAADNAEESRYITQEELHYIES-----SLKHNEDYHKTVIPVPWMAIW 245
            ..:|..|.:. .:|..:....|  |...:....|..:.|     |||......:.::. |::.:.
Human   169 LALSGALCVV-VSFLCLLLIHN--EPADVGLRNLDPMPSEGKKGSLKEESTLQELLLS-PYLWVL 229

  Fly   246 TSAPFFALMVARCCETWG-LSTLQAQIPTYMNGVLDMDMKSNAFFSALPF------LAMWIMSYV 303
            ::.......|..||..|| ...:|.:..:.:.|        :::.|||..      :|...:|..
Human   230 STGYLVVFGVKTCCTDWGQFFLIQEKGQSALVG--------SSYMSALEVGGLVGSIAAGYLSDR 286

  Fly   304 YLIIADV-------------LLAGNRLSLTALRKIFNS-----LAFWI----PCATLIGIGFLDQ 346
            .:..|.:             ::||..:|:...|....|     :|||.    |.|.|  .||.:.
Human   287 AMAKAGLSNYGNPRHGLLLFMMAGMTVSMYLFRVTVTSDSPKDVAFWTLALHPLAEL--TGFTEH 349

  Fly   347 EQKNLAIALMTISVGVNSGATIG-SSLNTIDL---------SPNHASILMGIVNTAANVVPIVTP 401
            |...|.:           ||..| ||...|.|         .||.......||...|||...:..
Human   350 ELWILVL-----------GAVFGFSSYGPIALFGVIANESAPPNLCGTSHAIVGLMANVGGFLAG 403

  Fly   402 LAVGLIVHEDKNREEWQIVFIIAAVIFFIGNCVF 435
            |....|.    ....|...|.:|.||.......|
Human   404 LPFSTIA----KHYSWSTAFWVAEVICAASTAAF 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30265NP_001286747.1 2A0114euk 14..450 CDD:129972 92/424 (22%)
MFS 18..438 CDD:119392 92/424 (22%)
SLC37A4NP_001157750.1 MFS 14..437 CDD:119392 92/424 (22%)
2A0104 18..419 CDD:273319 87/408 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148683
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.