DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30265 and F41C3.2

DIOPT Version :9

Sequence 1:NP_001286747.1 Gene:CG30265 / 37622 FlyBaseID:FBgn0050265 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_494849.2 Gene:F41C3.2 / 173821 WormBaseID:WBGene00018268 Length:499 Species:Caenorhabditis elegans


Alignment Length:451 Identity:101/451 - (22%)
Similarity:183/451 - (40%) Gaps:41/451 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MRHVQTLLLFFNITCLYIGRLNVGVAVVAMTNAESTNPDFPEYDWTLTQKSYILSSFFWGYIITQ 77
            |..||..:..:|.|.|.:..........:::..|:..|....::::..::..:.|:.:...:.:.
 Worm    45 MTLVQANVHVYNFTVLCMQEEQEKANNESLSRNETILPSSLNFNFSKFEQDLLFSAAYIAPLPSI 109

  Fly    78 FLGGYLCKRYGVKSVMLWGSFASGIFSALTPLFIGFGEWQAYCGIRVLMGFAQGLIFPCIHQHLA 142
            .:..:|..|.|||:..|..|..|.:.:.|||:...:|.| .:...|...|....::...:.....
 Worm   110 IILYFLTNRSGVKTTFLICSMLSFLSTILTPIATQYGFW-FFWAARFFQGLPTAILGIVVSVVTC 173

  Fly   143 RWSPPAERNRLGALSHTGIECGNVCAMFFSGMIAKSAIGWPGISYVSAGLALAWCAFWFVFAADN 207
            .||...|.....::.....:...:..|..|.::. |..||..:.|....:.......:.||..|.
 Worm   174 HWSTLTENGTYVSILAAHYQIAPLLTMPLSALMC-SVGGWSSVYYTQGTITAILIVLFAVFYTDK 237

  Fly   208 AEESRYITQEELHYIESSLKHNEDYHKTVIPVPWMAIWTSAPFFALMVARCCETWGLSTLQAQIP 272
            ..||:::::.||..||.. |..|:.|......|::||......:|:.:.....|.|.|......|
 Worm   238 PSESKFVSKGELKAIEDG-KSLEEKHVEKSKTPFVAIHKDPAVWAIWITSVGGTIGFSIFLQYGP 301

  Fly   273 TYMNGVLDMDMKSNAFFSALPFLAMWIMSYVYLIIADVLLA-----GNRLS---LTALRKIFNSL 329
            ||:|.||..::.:..:.:|:|:    |.|.:..|:|..|.|     |.||:   .|.:.:...::
 Worm   302 TYLNKVLHYNLSTTGWTAAVPY----IFSCIARIVAQPLSANCSFLGERLAAIVTTTISQGTMAI 362

  Fly   330 AF----WIPCATLIGIGFLDQEQKNLAIALMTISVGVNS-GATIGSSLNTIDLSPNHASILMGIV 389
            .|    :|| .|...:|       .|..:|:.::.|:|. |.|..:.|    :...|    |..|
 Worm   363 CFLVLMFIP-QTWSSVG-------QLCYSLVIVANGLNGVGITRSAQL----VCKQH----MSFV 411

  Fly   390 NTAA----NVVPIVTPLAVGLIVHEDKNREEWQIVFIIAAVIFFIGNCVFLYYGTAVSQPW 446
            .||.    ..|.:..||.|..:...| ...||..:|:|...|.|:.|.:|:.:.:.....|
 Worm   412 YTARAFYNGSVGLFLPLLVNFVAPND-THNEWTRLFLIIFCIVFVSNLIFIAFSSTEPAQW 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30265NP_001286747.1 2A0114euk 14..450 CDD:129972 100/450 (22%)
MFS 18..438 CDD:119392 97/436 (22%)
F41C3.2NP_494849.2 2A0114euk 30..471 CDD:129972 100/449 (22%)
MFS 86..463 CDD:119392 92/400 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.