DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42284 and YCR051W

DIOPT Version :10

Sequence 1:NP_611720.3 Gene:CG42284 / 37621 FlyBaseID:FBgn0259179 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_009980.1 Gene:YCR051W / 850418 SGDID:S000000647 Length:222 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:39/164 - (23%)
Similarity:66/164 - (40%) Gaps:44/164 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 AARDGGLLALQQALDRRKFAIAKNDISPNGSTPLHVAVLFGHTDIVRYLASRFPETMTITDNDGR 201
            ||.||.|..::..|...|.|:.......||.||:|.|..:||.|:::.:.:.:...:.:.||||.
Yeast     8 AASDGNLDRVEHILRESKGAMTPQSKDINGYTPMHAAAAYGHLDLLKKMCNEYNGDINVLDNDGD 72

  Fly   202 TPLHYAATIKD--------NGHF----------YNMLLQLGANPKSLDKL-------------GH 235
            ||||:...:..        .|.|          |:..::.|.:.:.::.:             |.
Yeast    73 TPLHHVEDVATARLIVEELGGDFTIRNVEGQTPYDSFVENGEDGELIEYMRIKSGVADVHGVDGV 137

  Fly   236 SAEFYLDK---EKAKNILNYTELLNIFGAEELEN 266
            ..|..:|.   |:.|:.:.||          |||
Yeast   138 QGEGVIDSKLLEEFKDNVRYT----------LEN 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42284NP_611720.3 Ank_2 135..231 CDD:463710 29/111 (26%)
ANK repeat 165..197 CDD:293786 9/31 (29%)
Dpy-30 289..330 CDD:428357
Ank_2 533..630 CDD:463710
ANK repeat 564..596 CDD:293786
ANK repeat 598..630 CDD:293786
YCR051WNP_009980.1 ANK repeat 5..34 CDD:293786 8/25 (32%)
ANKYR <7..172 CDD:440430 39/164 (24%)
ANK repeat 36..68 CDD:293786 9/31 (29%)
ANK repeat 70..99 CDD:293786 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.