DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42284 and YCR051W

DIOPT Version :9

Sequence 1:	NP_611720.3	Gene:	CG42284 / 37621	FlyBaseID:	FBgn0259179	Length:	657	Species:	Drosophila melanogaster
Sequence 2:	NP_009980.1	Gene:	YCR051W / 850418	SGDID:	S000000647	Length:	222	Species:	Saccharomyces cerevisiae

Alignment Length:	164	Identity:	39/164 - (23%)
Similarity:	66/164 - (40%)	Gaps:	44/164 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly   137 AARDGGLLALQQALDRRKFAIAKNDISPNGSTPLHVAVLFGHTDIVRYLASRFPETMTITDNDGR 201
            ||.||.|..::..|...|.|:.......||.||:|.|..:||.|:::.:.:.:...:.:.||||.
Yeast     8 AASDGNLDRVEHILRESKGAMTPQSKDINGYTPMHAAAAYGHLDLLKKMCNEYNGDINVLDNDGD 72

  Fly   202 TPLHYAATIKD--------NGHF----------YNMLLQLGANPKSLDKL-------------GH 235
            ||||:...:..        .|.|          |:..::.|.:.:.::.:             |.
Yeast    73 TPLHHVEDVATARLIVEELGGDFTIRNVEGQTPYDSFVENGEDGELIEYMRIKSGVADVHGVDGV 137

  Fly   236 SAEFYLDK---EKAKNILNYTELLNIFGAEELEN 266
            ..|..:|.   |:.|:.:.||          |||
Yeast   138 QGEGVIDSKLLEEFKDNVRYT----------LEN 161

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42284	NP_611720.3	ANK	135..250	CDD:238125	34/146 (23%)
		Ank_2	135..231	CDD:289560	29/111 (26%)
		ANK repeat	165..197	CDD:293786	9/31 (29%)
		Dpy-30	289..330	CDD:253069
		ANK	407..585	CDD:238125
		ANK	533..649	CDD:238125
		Ank_2	533..630	CDD:289560
		ANK repeat	564..596	CDD:293786
		ANK repeat	598..630	CDD:293786
YCR051W	NP_009980.1	ANKYR	1..222	CDD:223738	39/164 (24%)
		Ank_2	5..99	CDD:403870	27/90 (30%)
		ANK repeat	5..34	CDD:293786	8/25 (32%)
		ANK repeat	36..68	CDD:293786	9/31 (29%)
		ANK repeat	70..99	CDD:293786	8/28 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	1	1.000	-	-		oto99670
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000