DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42284 and Ankrd7

DIOPT Version :9

Sequence 1:NP_611720.3 Gene:CG42284 / 37621 FlyBaseID:FBgn0259179 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001161229.1 Gene:Ankrd7 / 75196 MGIID:1922446 Length:280 Species:Mus musculus


Alignment Length:178 Identity:47/178 - (26%)
Similarity:75/178 - (42%) Gaps:34/178 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 IHRVHDAARDGGLLALQQALDRRKFAIAKNDISPNGSTPLHVAVLFGHTDIVRYLASRFPETMTI 195
            :.::|.||..|....|:..|:|:|:.:  |.......||||:|...|:|:||..|.....: :.:
Mouse    48 LKKLHKAATIGNEQKLKDYLERKKYNV--NGRDKRSRTPLHLACANGYTNIVSLLIENQCK-INV 109

  Fly   196 TDNDGRTPLHYAATIKDNGHFYNMLLQLGANPKSLDKLGHSAEFYLDKEKAKNILNYTELLNIFG 260
            .|::.||||...|..........:||..||:|..:|...::|..|  ....:||           
Mouse   110 QDSENRTPLIKQAVECQQESCATVLLLHGADPNLVDVYSNTALHY--AVCGQNI----------- 161

  Fly   261 AEELENQLLNDQGQAQPVSFQANPIFKTEQGKYLADSLADPLIKALTE 308
              .|.|:||         .::||...|.:.|.       .||:.|:.|
Mouse   162 --SLANKLL---------QYKANLEAKNKDGH-------TPLLLAVAE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42284NP_611720.3 ANK 135..250 CDD:238125 34/114 (30%)
Ank_2 135..231 CDD:289560 30/95 (32%)
ANK repeat 165..197 CDD:293786 10/31 (32%)
Dpy-30 289..330 CDD:253069 5/20 (25%)
ANK 407..585 CDD:238125
ANK 533..649 CDD:238125
Ank_2 533..630 CDD:289560
ANK repeat 564..596 CDD:293786
ANK repeat 598..630 CDD:293786
Ankrd7NP_001161229.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Ank_2 51..145 CDD:289560 30/96 (31%)
ANK repeat 51..78 CDD:293786 9/28 (32%)
ANK 75..201 CDD:238125 39/149 (26%)
ANK repeat 80..111 CDD:293786 10/31 (32%)
ANK 1 80..109 10/29 (34%)
ANK repeat 113..145 CDD:293786 10/31 (32%)
Ank_2 121..211 CDD:289560 23/102 (23%)
ANK repeat 147..178 CDD:293786 10/54 (19%)
ANK 3 147..176 10/52 (19%)
ANK 176..>260 CDD:238125 6/23 (26%)
ANK repeat 180..211 CDD:293786 5/19 (26%)
ANK 4 180..209 5/19 (26%)
Ank_5 200..254 CDD:290568
ANK repeat 213..244 CDD:293786
ANK 5 213..242
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5235
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.