DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42284 and nompC

DIOPT Version :9

Sequence 1:NP_611720.3 Gene:CG42284 / 37621 FlyBaseID:FBgn0259179 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_523483.2 Gene:nompC / 33768 FlyBaseID:FBgn0016920 Length:1761 Species:Drosophila melanogaster


Alignment Length:846 Identity:182/846 - (21%)
Similarity:292/846 - (34%) Gaps:256/846 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EEREPESENDNDDDDEDVIASDSKGANPQEGQQPGAGAQPPEDDGNESLTSAM------------ 56
            |...|.|:.|:|..|:.....|.|..:.....:|.:......|..|:.|..||            
  Fly    36 ERATPASKADSDPKDDSSSNGDKKDMDLFPAPKPPSAGASIRDTANKVLGLAMKSEWTPIEAELK 100

  Fly    57 AIEGFVHGAPED---------------------YTVQSQTAV---------------DENERIKR 85
            .:|.:|....||                     .|..::||:               ::|..:..
  Fly   101 KLEKYVANVGEDGNHIPLAGVHDMNTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLH 165

  Fly    86 IVESGDLEQLAEIVLN-------GEGGS-----------------------LVGLKSPEPEIQA- 119
            |......|.:.:::|.       ..|||                       |:.....:..::| 
  Fly   166 IAAMYSREDVVKLLLTKRGVDPFSTGGSRSQTAVHLVSSRQTGTATNILRALLAAAGKDIRLKAD 230

  Fly   120 ------FLNNVPSYMEKIHRVHDAARD---------GGLLALQQALDRRKFAIAK--NDISPN-- 165
                  .|..|.|..:.:.|...||:.         .|..||..|..||...:.:  .|...|  
  Fly   231 GRGKIPLLLAVESGNQSMCRELLAAQTAEQLKATTANGDTALHLAARRRDVDMVRILVDYGTNVD 295

  Fly   166 -----GSTPLHVAVLFGHTDIVRYLASRFPETMTITDNDGRTPLHYAATIKDNGHFYNMLLQLGA 225
                 |.||||:|...|...:::|... ...:.:|.||..|||:|.||   :|||          
  Fly   296 TQNGEGQTPLHIAAAEGDEALLKYFYG-VRASASIADNQDRTPMHLAA---ENGH---------- 346

  Fly   226 NPKSLDKLGHSAEFYLDKEKAKNILNYTELLNIFGAEELENQLLNDQGQAQPVSFQANPIFKTEQ 290
                    .|..|...||.|| :|...|:    .|:..:....||...:.      |..:||  :
  Fly   347 --------AHVIEILADKFKA-SIFERTK----DGSTLMHIASLNGHAEC------ATMLFK--K 390

  Fly   291 GKYL-------ADSLADPLIKALTEIAN----KRPRDPVAYLTNY--LQHFMGDRKPM------- 335
            |.||       |.|:........|.|.|    |..:..|....||  |...:...||.       
  Fly   391 GVYLHMPNKDGARSIHTAAAYGHTGIINTLLQKGEKVDVTTNDNYTALHIAVESAKPAVVETLLG 455

  Fly   336 --TEVQVHSG---------SSKASTSSTSTLALPKSNASSNQRLGNTRNGPGPTNADL---IELD 386
              .:|.|..|         :::........|.|.||.||           |..|..|.   :.:.
  Fly   456 FGADVHVRGGKLRETPLHIAARVKDGDRCALMLLKSGAS-----------PNLTTDDCLTPVHVA 509

  Fly   387 ARSVAEDEDAEGALA--VQHMEE------RDEHGQSMLHFACARSHR---RGALYTLIEESGID- 439
            ||        .|.||  :|.:|:      :...|::.||.||...|.   |..:.|:.|:.|.| 
  Fly   510 AR--------HGNLATLMQLLEDEGDPLYKSNTGETPLHMACRACHPDIVRHLIETVKEKHGPDK 566

  Fly   440 -ITYRDE--------LYRTARDVSLQANQPNNAAEIDRYVMAQAVIGDV---------EPFEQLA 486
             .||.:.        |:.|.:....:...|.:..:|.|.::...  .||         ..|...|
  Fly   567 ATTYINSVNEDGATALHYTCQITKEEVKIPESDKQIVRMLLENG--ADVTLQTKTALETAFHYCA 629

  Fly   487 LQGYDHILDIEDENGQSITDV--VQSRQNAA----------------LGEFLANLKALE----ES 529
            :.|.:.:| :|..:..:.||:  ..:||::.                :...|||...::    |.
  Fly   630 VAGNNDVL-MEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELVNNLLANHARVDVFDTEG 693

  Fly   530 REELHQMIRENNMERVVE--LTNVANAKWLIRTKNYYGRTALHIAVLKESEEMVQHMVKICPEGL 592
            |..|| :..|.....|.:  |||    |..|.:|:..||||||:|.:.....:|:.::|.....:
  Fly   694 RSALH-LAAERGYLHVCDALLTN----KAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVI 753

  Fly   593 KITDNLERTVLHYAMGTNALESVSRILIQNGAKRTAKDLKGRQPSYYFI--NKADILRLQEEEEE 655
            .|....::|.||.|..:..:| |.::|::.||...|.|..|::|.:...  |.:::.:|..::..
  Fly   754 DILTLRKQTPLHLAAASGQME-VCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQHP 817

  Fly   656 S 656
            |
  Fly   818 S 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42284NP_611720.3 ANK 135..250 CDD:238125 36/132 (27%)
Ank_2 135..231 CDD:289560 30/113 (27%)
ANK repeat 165..197 CDD:293786 10/38 (26%)
Dpy-30 289..330 CDD:253069 13/53 (25%)
ANK 407..585 CDD:238125 52/229 (23%)
ANK 533..649 CDD:238125 34/119 (29%)
Ank_2 533..630 CDD:289560 30/98 (31%)
ANK repeat 564..596 CDD:293786 10/31 (32%)
ANK repeat 598..630 CDD:293786 10/31 (32%)
nompCNP_523483.2 ANK repeat 129..157 CDD:293786 3/27 (11%)
Ank_2 131..228 CDD:289560 11/96 (11%)
ANK 155..319 CDD:238125 30/163 (18%)
ANK repeat 159..186 CDD:293786 4/26 (15%)
ANK repeat 232..265 CDD:293786 6/32 (19%)
Ank_2 237..331 CDD:289560 23/94 (24%)
ANK 263..387 CDD:238125 40/156 (26%)
ANK repeat 267..298 CDD:293786 8/30 (27%)
ANK repeat 300..331 CDD:293786 9/31 (29%)
Ank_2 305..398 CDD:289560 34/127 (27%)
ANK 329..454 CDD:238125 41/158 (26%)
ANK repeat 367..398 CDD:293786 9/38 (24%)
ANK repeat 400..431 CDD:293786 7/30 (23%)
Ank_2 405..498 CDD:289560 20/103 (19%)
ANK 428..555 CDD:238125 32/145 (22%)
ANK repeat 433..463 CDD:293786 6/29 (21%)
ANK repeat 469..499 CDD:293786 7/40 (18%)
ANK 496..641 CDD:238125 34/155 (22%)
ANK repeat 501..532 CDD:293786 8/38 (21%)
Ank_2 507..616 CDD:289560 27/118 (23%)
ANK repeat 534..575 CDD:293786 13/40 (33%)
ANK repeat 577..616 CDD:293786 7/40 (18%)
Ank_2 625..722 CDD:289560 23/102 (23%)
ANK 654..780 CDD:238125 33/131 (25%)
ANK repeat 660..690 CDD:293786 3/29 (10%)
ANK repeat 692..723 CDD:293786 11/35 (31%)
Ank_2 697..790 CDD:289560 30/98 (31%)
ANK 720..847 CDD:238125 27/100 (27%)
ANK repeat 725..757 CDD:293786 10/31 (32%)
ANK repeat 759..790 CDD:293786 10/31 (32%)
Ank_5 779..834 CDD:290568 10/40 (25%)
ANK 787..915 CDD:238125 7/32 (22%)
ANK repeat 792..824 CDD:293786 5/27 (19%)
ANK repeat 861..893 CDD:293786
Ank_4 865..915 CDD:290365
Ank_4 929..995 CDD:290365
ANK repeat 932..972 CDD:293786
ANK 969..1096 CDD:238125
ANK repeat 974..1007 CDD:293786
Ank_2 979..1074 CDD:289560
ANK repeat 1009..1041 CDD:293786
ANK 1039..1159 CDD:238125
ANK repeat 1043..1074 CDD:293786
Ank_2 1048..1135 CDD:289560
ANK repeat 1076..1101 CDD:293786
ANK repeat 1109..1134 CDD:293786
Ion_trans <1393..1598 CDD:278921
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.