DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stl and Ppn

DIOPT Version :9

Sequence 1:NP_001097423.1 Gene:stl / 37619 FlyBaseID:FBgn0086408 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster


Alignment Length:518 Identity:120/518 - (23%)
Similarity:170/518 - (32%) Gaps:170/518 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   655 IRHEPNRIPPL-------LHDYNPMDNELPG----SPSNWGEWSEPSACESGCLYGQSRRLLEGS 708
            |....:|.|.|       .:.|.|..:..||    .|..|..||.||.|...|           .
  Fly    21 IHDSQSRFPGLRQKRQYGANMYLPESSVTPGGEGNDPDEWTPWSSPSDCSRTC-----------G 74

  Fly   709 TGLRTLNRSCLNFPSR----CIGRDRRFVTCNTPQCHKVPVQTINDFATQVCMQARKSDPELTGE 769
            .|:....|.||....|    |.|..||:.:|||..|   |.:. :||..|.|  :|....:..|.
  Fly    75 GGVSYQTRECLRRDDRGEAVCSGGSRRYFSCNTQDC---PEEE-SDFRAQQC--SRFDRQQFDGV 133

  Fly   770 GQQ-LPST-LDASCKIFCRTRTNGTK---SRRWTFPDGTTCKAKQHNPEDITYCISGRCERFSCD 829
            ..: :|.| ....|::.|..:  |.:   .:|....|||.|     |.:|:..|::|.|....||
  Fly   134 FYEWVPYTNAPNPCELNCMPK--GERFYYRQREKVVDGTRC-----NDKDLDVCVNGECMPVGCD 191

  Fly   830 NSTSNFFKM--------DSSFCEARSVRPTRDSSDQE---------SRQQTNRQRYAERQEGKPQ 877
            ....:..|.        |.|.|  :::|.|..:.|..         ....||    ...:|..|.
  Fly   192 MMLGSDAKEDKCRKCGGDGSTC--KTIRNTITTKDLAPGYNDLLLLPEGATN----IRIEETVPS 250

  Fly   878 KN---------HYENEVAKRPSYGQGN-HINAPASPYKRR---NY-HKPY---PPEIPRPPPPAS 925
            .|         ||         |..|: .|:.|...:...   || .||.   .|:......|.|
  Fly   251 SNYLACRNHSGHY---------YLNGDWRIDFPRPMFFANSWWNYQRKPMGFAAPDQLTCSGPIS 306

  Fly   926 ASL----------IALD----------RSSSSESEWVAHP--GCHSNCMTDSKGVQGVT--SRLT 966
            .||          |:||          .|......|..|.  .|.::|...|:. :.||  :|:|
  Fly   307 ESLFIVMLVQEKNISLDYEYSIPESLSHSQQDTHTWTHHQFNACSASCGGGSQS-RKVTCNNRIT 370

  Fly   967 GVE-SIQLCSYRIQPCERLQTAAEYAEQTC-----------ARYRQKVRGLSGHGAQ-------- 1011
            ..| :..||..:.:|.|         ||.|           ..:.:..:|....|.|        
  Fly   371 LAEVNPSLCDQKSKPVE---------EQACGTEPCAPHWVEGEWSKCSKGCGSDGFQNRSITCER 426

  Fly  1012 ISASID---EPDRSC--RVG--------CQDEFIKYRYYLVNGRNGHFPPGTRCSPV---GKR 1058
            ||:|.:   |.|..|  .||        |..:       :.|....|..|.|.|..:   ||:
  Fly   427 ISSSGEHTVEEDAVCLKEVGNKPATKQECNRD-------VKNCPKYHLGPWTPCDKLCGDGKQ 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stlNP_001097423.1 Pep_M12B_propep <155..239 CDD:279848
ZnMc_ADAMTS_like 331..543 CDD:239801
Reprolysin 332..545 CDD:279729
TSP1 683..741 CDD:214559 19/61 (31%)
PpnNP_788752.2 TSP1 60..111 CDD:214559 20/64 (31%)
ADAM_spacer1 214..329 CDD:283607 26/127 (20%)
TSP1 468..521 CDD:214559 5/15 (33%)
TSP_1 645..693 CDD:278517
Kunitz_BPTI 1611..1663 CDD:278443
Kunitz_BPTI 1670..1721 CDD:278443
Kunitz_BPTI 1729..1781 CDD:278443
Kunitz_BPTI 1789..1840 CDD:278443
Kunitz_BPTI 1848..1899 CDD:278443
KU 1920..1973 CDD:238057
Kunitz_BPTI 2001..2051 CDD:278443
KU 2071..2121 CDD:238057
Kunitz_BPTI 2127..2178 CDD:278443
KU 2192..2245 CDD:238057
KU 2251..2304 CDD:238057
KU 2316..2372 CDD:238057
WAP 2457..2497 CDD:278522
Ig 2521..2610 CDD:299845
IG_like 2530..2610 CDD:214653
IG_like 2627..2703 CDD:214653
Ig 2636..2701 CDD:143165
IG_like 2766..2841 CDD:214653
Ig 2768..2830 CDD:299845
PLAC 2851..2883 CDD:285849
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13723
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.