DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stl and loh

DIOPT Version :9

Sequence 1:NP_001097423.1 Gene:stl / 37619 FlyBaseID:FBgn0086408 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_609406.2 Gene:loh / 34435 FlyBaseID:FBgn0032252 Length:880 Species:Drosophila melanogaster


Alignment Length:231 Identity:47/231 - (20%)
Similarity:75/231 - (32%) Gaps:63/231 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   642 PPEHIPEATHEKIIRHEPNRIPPLLHDYNPMDNELPGSPSNWGEWSEPSACESGCLYGQSRRLLE 706
            ||:....:|.:|..:.        ::.|           ..|.:||:.|:|...|          
  Fly   160 PPQEATSSTSKKAKKK--------VYPY-----------PRWDKWSDWSSCSRSC---------- 195

  Fly   707 GSTGLRTLNRSCLN---------FPSRCIGRDRRFVTCNTPQCHKVPVQTINDFATQVCMQARKS 762
             ..|::...|.|:|         ..:.|:|..:|:..||...|.    :...||....|  :..:
  Fly   196 -GGGVKYQVRKCINRNLLTNNQLTSNACVGYFKRYQLCNDVPCD----EQSPDFRASQC--SAYN 253

  Fly   763 DPELTGEGQQLPSTL--DASCKIFCRTRTNGTKS---RRWTFPDGTTCKAKQHNPE-------DI 815
            |.|..|...:....:  ||.|::.|  ...|.||   ...:..|||.|   .|..|       :.
  Fly   254 DKEFHGHRYRWEPYVKDDAECELNC--MPFGMKSFATLNESVIDGTPC---GHPAEYFRSQFWER 313

  Fly   816 TYCISGRCERFSCDNSTSNFFKMDSSF-CEARSVRP 850
            ..|:.|.|:...........:....|. |.....||
  Fly   314 AVCVDGACKAVQASGEIDGLYAHSGSVSCGGLLCRP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stlNP_001097423.1 Pep_M12B_propep <155..239 CDD:279848
ZnMc_ADAMTS_like 331..543 CDD:239801
Reprolysin 332..545 CDD:279729
TSP1 683..741 CDD:214559 15/66 (23%)
lohNP_609406.2 TSP1 182..238 CDD:214559 15/66 (23%)
ADAM_spacer1 348..468 CDD:283607 2/2 (100%)
TSP1 667..716 CDD:214559
TSP1 779..835 CDD:214559
PLAC 847..877 CDD:285849
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.