DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stl and ADAMTSL5

DIOPT Version :9

Sequence 1:NP_001097423.1 Gene:stl / 37619 FlyBaseID:FBgn0086408 Length:1136 Species:Drosophila melanogaster
Sequence 2:XP_011526263.1 Gene:ADAMTSL5 / 339366 HGNCID:27912 Length:485 Species:Homo sapiens


Alignment Length:182 Identity:54/182 - (29%)
Similarity:74/182 - (40%) Gaps:42/182 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   941 WVAHPGCHSNCMTDSKGVQGVTS----RLTGVESIQLCSYRIQPCERLQT---AAEYAEQTCARY 998
            ||:...|.|:|   .:|| .|.|    ||.|.|.....|:..:.|:....   |..:.:..||.|
Human    51 WVSWTRCSSSC---GRGV-SVRSRRCLRLPGEEPCWGDSHEYRLCQLPDCPPGAVPFRDLQCALY 111

  Fly   999 R-------QKV-RGLSGHGAQISASIDEPDRSCRVGCQDEFIKYRYYLVNGRNGHFPPGTRCSPV 1055
            .       ||. :.:..|||        |:: |.:.|..|  .:.:|...||   ...||.|||.
Human   112 NGRPVLGTQKTYQWVPFHGA--------PNQ-CDLNCLAE--GHAFYHSFGR---VLDGTACSPG 162

  Fly  1056 GKRYCVYGRCLEFGDDDLPLDKTHISLGQLRTRRKRSSISND--LFNITEIF 1105
            .:..||.||||..|.|.|      :..|.|..|..|...:||  || :..:|
Human   163 AQGVCVAGRCLSAGCDGL------LGSGALEDRCGRCGGANDSCLF-VQRVF 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stlNP_001097423.1 Pep_M12B_propep <155..239 CDD:279848
ZnMc_ADAMTS_like 331..543 CDD:239801
Reprolysin 332..545 CDD:279729
TSP1 683..741 CDD:214559
ADAMTSL5XP_011526263.1 TSP1 48..97 CDD:214559 15/49 (31%)
ADAM_CR <106..174 CDD:301627 25/81 (31%)
ADAM_spacer1 206..315 CDD:283607 1/2 (50%)
NTR_like 379..480 CDD:239600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13723
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.