DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stl and Adamtsl5

DIOPT Version :9

Sequence 1:NP_001097423.1 Gene:stl / 37619 FlyBaseID:FBgn0086408 Length:1136 Species:Drosophila melanogaster
Sequence 2:XP_038934914.1 Gene:Adamtsl5 / 314626 RGDID:1305607 Length:714 Species:Rattus norvegicus


Alignment Length:333 Identity:63/333 - (18%)
Similarity:86/333 - (25%) Gaps:144/333 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 DGLPW--------TSHPALEGTEC---GPNMWCRG------------------------------ 622
            |.|||        |..|:.....|   .|..|..|                              
  Rat    50 DALPWALSNWVSETHGPSSASFHCTDEEPEAWKNGMVGSWPPRKRTHDWFQAPMPCCEQLELSLA 114

  Fly   623 -------GTCEA--RSSKQGSYSALKSWPPEHIPEATHEKIIRH---------------EPNRIP 663
                   .:|.|  |:..:|....   |.|....::...::..|               .|...|
  Rat   115 QRESVHLASCRAALRAQTRGPREV---WLPSKTTQSARAEMAVHSDSADHCLLGTQCSLRPRLFP 176

  Fly   664 PLLH-DYNPMDNELPGS---PSNWGEWSEPSACESGCLYGQSRRLLEGSTGLRTLNRSCLNFPSR 724
            |||. .:..:..:|.|:   |..|..|...|.|.|.|..|.|.|           .|.|:..|..
  Rat   177 PLLFLLWILLSCDLRGAAQGPGEWTLWGSWSRCSSSCGRGVSVR-----------RRHCVRLPEE 230

  Fly   725 --CIGRDRRFVTCNTPQCHKVPVQTINDFATQVCMQARKSDPELTGEGQQLPSTL---DASCKIF 784
              |.|....:..|      ::|........||.|.                |..:   |..|.::
  Rat   231 ELCWGDSHEYRVC------QLPFYPSTFMLTQDCP----------------PGAIPFRDLQCSLY 273

  Fly   785 CRTRTNGT-KSRRWTFP---------------------------DGTTCKAKQHNPEDITYCISG 821
            ......|| |:.:|. |                           |||.|     .|.....|::|
  Rat   274 NGHPVLGTQKTYQWV-PFHGAPNLCDLNCLAEGHAFYHSFGRVLDGTPC-----TPGTQGLCVAG 332

  Fly   822 RCERFSCD 829
            ||....||
  Rat   333 RCLSAGCD 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stlNP_001097423.1 Pep_M12B_propep <155..239 CDD:279848
ZnMc_ADAMTS_like 331..543 CDD:239801
Reprolysin 332..545 CDD:279729
TSP1 683..741 CDD:214559 15/59 (25%)
Adamtsl5XP_038934914.1 TSP1 200..246 CDD:214559 15/62 (24%)
ADAM_spacer1 444..541 CDD:368694
NTR_like 608..707 CDD:239600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.