DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stl and Cfp

DIOPT Version :9

Sequence 1:NP_001097423.1 Gene:stl / 37619 FlyBaseID:FBgn0086408 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_001100227.1 Gene:Cfp / 299314 RGDID:1594557 Length:465 Species:Rattus norvegicus


Alignment Length:428 Identity:84/428 - (19%)
Similarity:122/428 - (28%) Gaps:187/428 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 IYSCTINEAKHFESVFVVAHEIGHNLGMRHDAK-------------EISCDPTMHI--------- 510
            :..|.:|.|..|:.         |:.|:....:             .::|.....:         
  Rat    49 VEDCCLNTAYAFQE---------HDGGLCQSCRSPQWSAWSSWGPCSVTCSEGSQLRHRRCVGRG 104

  Fly   511 --MSPKLGSGKVTW--SKCSRTYLEDFLMDPQAECLFDRDSFAGPW------------------D 553
              .|.|...|.:.|  ..|     ||.|..|:    ....|..|||                  |
  Rat   105 GQCSEKAAPGTLEWQLQAC-----EDQLCCPE----MGGWSEWGPWGPCSVTCSKGTQTRQRLCD 160

  Fly   554 HTA---GGRLPGERFNANQQCMLRFGKNFMQASTQSKMEICRDLHCRQDGLPWTSHPALEGTECG 615
            :.|   ||..|||. ..:|.|           .||   :||..........||:   |..|:   
  Rat   161 NPAPKCGGHCPGEA-QQSQAC-----------DTQ---KICPTHGAWASWGPWS---ACSGS--- 204

  Fly   616 PNMWCRGGTCEARSSKQGSYSALKSWPPEHIPEATHEKIIRHEPNRIPP------LLHDYNPMDN 674
                |.||..|.:.::..|.||         |..:|:          ||      ..:::.....
  Rat   205 ----CLGGAQEPKETRSRSCSA---------PAPSHQ----------PPGKPCSGTAYEHRGCSG 246

  Fly   675 ELPGSP--SNWGEWSEPSACESGCLYGQSRRLLEGSTGLRTLNRSCLNFP------SRCIGRDRR 731
             ||..|  ..||.|...|.|...|..||            ||.|...:.|      ..|.|...|
  Rat   247 -LPPCPVAGGWGPWGPSSPCPVTCGLGQ------------TLERRTCDHPVPRHGGPFCAGDATR 298

  Fly   732 FVTCNT----------------PQCHKVPVQTINDFATQVCMQARKSDPELTGEGQQLPSTLDAS 780
            ...|||                ..|.:|.:::|             |..|:.|:           
  Rat   299 KHVCNTAMPCPVNGEWEAWGKWSHCSRVRMKSI-------------SCDEIPGQ----------- 339

  Fly   781 CKIFCRTRTNGTKSRRWTFPDGTTCKAKQHNPEDITYC 818
                 ::|:.....|::   ||..|..|.   :||.:|
  Rat   340 -----QSRSRSCGGRKF---DGQPCTGKL---QDIRHC 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stlNP_001097423.1 Pep_M12B_propep <155..239 CDD:279848
ZnMc_ADAMTS_like 331..543 CDD:239801 16/100 (16%)
Reprolysin 332..545 CDD:279729 16/102 (16%)
TSP1 683..741 CDD:214559 18/79 (23%)
CfpNP_001100227.1 TSP_1 77..128 CDD:278517 8/55 (15%)
TSP_1 136..184 CDD:278517 15/62 (24%)
TSP1 192..251 CDD:214559 17/88 (19%)
TSP_1 257..303 CDD:278517 14/57 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.