DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stl and Wfikkn2

DIOPT Version :9

Sequence 1:NP_001097423.1 Gene:stl / 37619 FlyBaseID:FBgn0086408 Length:1136 Species:Drosophila melanogaster
Sequence 2:XP_006533560.1 Gene:Wfikkn2 / 278507 MGIID:2669209 Length:585 Species:Mus musculus


Alignment Length:532 Identity:103/532 - (19%)
Similarity:152/532 - (28%) Gaps:208/532 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 PLHYDHALVLTGLDLVTYDKGKANSQVVGMATVKGMCTSIYSCTINE--------------AKHF 479
            |:.|.||.:... |:      ..|..|...:|.|..|.:...|...|              |::.
Mouse    46 PIRYSHAGICPN-DM------NPNLWVDAQSTCKRECETDQECETYEKCCPNVCGTKSCVAARYM 103

  Fly   480 ESVFVVAHEIGHNLGMRHDAKEISCDPTMHIMSPKLGSGKVTW---------SKCSRTYLEDFLM 535
            :    |..:.| .:||   .||.:||   |.|..:.||....|         .:|.:        
Mouse   104 D----VKGKKG-PVGM---PKEATCD---HFMCLQQGSECDIWDGQPVCKCKDRCEK-------- 149

  Fly   536 DPQAECLFDRDSFAGPWDHTAGGRLPGERFNANQQCMLRFGKNFMQASTQSKMEICRDLHCRQDG 600
            :|...|..|..::                          :.:.||.|...||......:.||.. 
Mouse   150 EPSFTCASDGLTY--------------------------YNRCFMDAEACSKGITLSVVTCRYH- 187

  Fly   601 LPW----------TSHPALEGTE-CGPNMWCRGGTCEARSSKQGSYSALKSWPPEHI-------- 646
            ..|          |.||.....| .|.:|               :..||.:.|....        
Mouse   188 FTWPNTSPPPPETTVHPTTASPETLGLDM---------------AAPALLNHPVHQSVTVGETVS 237

  Fly   647 ----------PEATHEKIIRHEPNRIPPLLHDYNPMDNELPGS---------------PSNWGEW 686
                      ||.|.||.:....|.:      ..|  |.:.|:               |.:.|.:
Mouse   238 FLCDVVGRPRPELTWEKQLEDRENVV------MRP--NHVRGNVVVTNIAQLVIYNVQPQDAGIY 294

  Fly   687 SEPSACESGCLY----------GQSRRLLEGS-TGLRTLNRSCLNFP-SRCIGRDR--------- 730
            :..:...:|.|.          ||:|...|.| .|.......||..| |...|.::         
Mouse   295 TCTARNVAGVLRADFPLSVVRGGQARATSESSLNGTAFPATECLKPPDSEDCGEEQTRWHFDAQA 359

  Fly   731 -RFVTCNTPQCHKVPVQTINDFAT-QVCMQARKSDPELTGEGQQLPSTLDASCKIFCRTRTNGTK 793
             ..:|.....||    ..:|.|.| :.||.|..|.|...   ..||: |...||.:.        
Mouse   360 NNCLTFTFGHCH----HNLNHFETYEACMLACMSGPLAI---CSLPA-LQGPCKAYV-------- 408

  Fly   794 SRRWTFPDGTTCKAKQHNPEDITYCISGRCERF---SCDNSTSNFFKMDSSFCEARSVRPTRDSS 855
             .||.:...|                 |.|:.|   .|:.:.:||...::  ||.....|   ..
Mouse   409 -PRWAYNSQT-----------------GLCQSFVYGGCEGNGNNFESREA--CEESCPFP---RG 450

  Fly   856 DQESRQQTNRQR 867
            :|..|....||:
Mouse   451 NQHCRACKPRQK 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stlNP_001097423.1 Pep_M12B_propep <155..239 CDD:279848
ZnMc_ADAMTS_like 331..543 CDD:239801 29/136 (21%)
Reprolysin 332..545 CDD:279729 29/138 (21%)
TSP1 683..741 CDD:214559 15/79 (19%)
Wfikkn2XP_006533560.1 WAP 51..100 CDD:365870 10/55 (18%)
KAZAL_FS 147..183 CDD:238052 9/69 (13%)
Ig_3 233..313 CDD:143242 13/87 (15%)
KU 337..388 CDD:238057 14/54 (26%)
Kunitz_BPTI 394..445 CDD:333766 16/82 (20%)
NTR_WFIKKN 464..572 CDD:239630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.