DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stl and Adamtsl3

DIOPT Version :10

Sequence 1:NP_001097423.1 Gene:stl / 37619 FlyBaseID:FBgn0086408 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_001177303.1 Gene:Adamtsl3 / 269959 MGIID:3028499 Length:1706 Species:Mus musculus


Alignment Length:265 Identity:67/265 - (25%)
Similarity:98/265 - (36%) Gaps:64/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   630 SKQGSYSALKSWPPEHIPEATHEKIIRHE-PNRIPPLLHDYNPMDNELPGSPSNWGEWSEPS-AC 692
            |.|||:          :.:.|.|:.:.:. .::.....|.....|    |:...||:||:.| .|
Mouse    53 SPQGSF----------LEDTTGEQFLTYRYDDQTSRNAHSEEDKD----GNWDAWGDWSDCSRTC 103

  Fly   693 ESGCLYGQSRRLLEGSTGLRTLNRSCLNFPSRCIGRDRRFVTCNTPQCHKVPVQTINDFATQVCM 757
            ..|..| ..||.|.|               ..|.|::.|:.||:...|   |... .||..|.| 
Mouse   104 GGGASY-SLRRCLTG---------------RNCEGQNIRYKTCSNHDC---PADA-EDFRAQQC- 147

  Fly   758 QARKSDPELTGEGQQ-LPSTLD--ASCKIFCRTRTNGTKSRRWTFP---DGTTCKAKQHNPEDIT 816
             :..:|.:..|...: :|...|  |.|.:.|..|  |........|   |||.|     |.:.:.
Mouse   148 -SAYNDVQYQGHYYEWIPLYNDPAAPCALKCHAR--GQSLVVELAPKVLDGTRC-----NADSLD 204

  Fly   817 YCISGRCERFSCDNSTSNFFKMDSSFCEARSVRPTRDSSDQESRQQTNRQRYAERQEGKPQKNHY 881
            .||||.|:...||....:..|.|:  |   .|.....|:.:..|.||......|::|        
Mouse   205 MCISGICQIVGCDRQLGSNAKEDN--C---GVCAGDGSTCRLVRGQTKMHLSPEKKE-------- 256

  Fly   882 ENEVA 886
            ||.:|
Mouse   257 ENVIA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stlNP_001097423.1 ZnMc_ADAMTS_like 331..543 CDD:239801
ADAMTS_CR_2 561..625 CDD:465496
TSP1 683..741 CDD:214559 17/58 (29%)
Adamtsl3NP_001177303.1 TSP1 90..136 CDD:214559 18/64 (28%)
ADAMTS_CR_3 141..239 CDD:437068 31/111 (28%)
TSP1_ADAMTS 355..413 CDD:465950
TSP1_ADAMTS 434..491 CDD:465950
TSP1_ADAMTS 494..546 CDD:465950
TSP1_ADAMTS 582..637 CDD:465950
TSP1_ADAMTS 661..716 CDD:465950
TSP1_ADAMTS 720..772 CDD:465950
TSP1_ADAMTS 776..832 CDD:465950
TSP1_ADAMTS 838..893 CDD:465950
Ig <942..1006 CDD:472250
Ig strand B 943..947 CDD:409353
Ig strand C 956..960 CDD:409353
Ig strand E 978..982 CDD:409353
Ig strand F 992..997 CDD:409353
Ig strand G 1001..1004 CDD:409353
Ig 1224..1291 CDD:409353
Ig strand B 1224..1228 CDD:409353
Ig strand C 1238..1242 CDD:409353
Ig strand E 1260..1264 CDD:409353
Ig strand F 1274..1279 CDD:409353
Ig strand G 1288..1291 CDD:409353
Ig 1331..1394 CDD:409353
Ig strand B 1331..1335 CDD:409353
Ig strand C 1344..1348 CDD:409353
Ig strand E 1364..1368 CDD:409353
Ig strand F 1378..1383 CDD:409353
TSP1_ADAMTS 1442..1497 CDD:465950
TSP1_ADAMTS 1501..1558 CDD:465950
TSP1_ADAMTS 1617..1670 CDD:465950
PLAC 1674..1704 CDD:462560
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.