DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and CCNE1

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001229.1 Gene:CCNE1 / 898 HGNCID:1589 Length:410 Species:Homo sapiens


Alignment Length:210 Identity:68/210 - (32%)
Similarity:108/210 - (51%) Gaps:30/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 ANDKE--NLVLVSE--YVNDIYDYLYQVELEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFH 305
            ||.:|  .::|..|  |:.|.: :|.|..|.||              ||||:|:||:.||...:.
Human   111 ANREEVWKIMLNKEKTYLRDQH-FLEQHPLLQP--------------KMRAILLDWLMEVCEVYK 160

  Fly   306 LAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQ 370
            |..|||.||....|||:...::..:|.|||:|:::||||.|.||::||.:..|.::||...:..:
Human   161 LHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDE 225

  Fly   371 IRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTM-----SKYFIELAS------VDYE 424
            |..|||.|.||:...||....:.:|..|.:.|...|.|..:     .:.||::|.      :|.:
Human   226 ILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVD 290

  Fly   425 MATYRPSEIAAASLF 439
            ...:....:||::|:
Human   291 CLEFPYGILAASALY 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 48/126 (38%)
Cyclin_C 389..515 CDD:281044 12/62 (19%)
CCNE1NP_001229.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Cyclin_N 115..242 CDD:306612 52/141 (37%)
Cyclin_C 245..363 CDD:308564 12/61 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146274
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.