DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and CCND3

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001751.1 Gene:CCND3 / 896 HGNCID:1585 Length:292 Species:Homo sapiens


Alignment Length:164 Identity:51/164 - (31%)
Similarity:77/164 - (46%) Gaps:11/164 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 QKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATK 346
            |:|:...||.:|..|:.||..:.....|.|.||:..:||||..| .|::..|||:|...:.:|:|
Human    49 QREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCV-PTRKAQLQLLGAVCMLLASK 112

  Fly   347 YEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHF----LRRYSKAAGAEDE 407
            ..|..|..|......||...:.||:|..|:.:...:..:|:..:...|    |.|.|.   ..|.
Human   113 LRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLA
AVIAHDFLAFILHRLSL---PRDR 174

  Fly   408 HHTMSKY---FIELASVDYEMATYRPSEIAAASL 438
            ...:.|:   |:.|.:.||..|.|.||.||..|:
Human   175 QALVKKHAQTFLALCATDYTFAMYPPSMIATGSI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 33/104 (32%)
Cyclin_C 389..515 CDD:281044 17/57 (30%)
CCND3NP_001751.1 Cyclin_N 27..153 CDD:306612 33/104 (32%)
Cyclin_C 155..>251 CDD:308564 17/57 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.