DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and CCNA2

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001228.2 Gene:CCNA2 / 890 HGNCID:1578 Length:432 Species:Homo sapiens


Alignment Length:468 Identity:124/468 - (26%)
Similarity:212/468 - (45%) Gaps:97/468 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GNGAVPPKVNEGGVSAFLRSNSVRNRVPTKTTVEPTKVTVKSSSSENVNEPTLKREDSNLSKKSL 158
            ||.|..|...|.| ||.|...        :|.::..:..:....:..|.:|              
Human     3 GNSAPGPATREAG-SALLALQ--------QTALQEDQENINPEKAAPVQQP-------------- 44

  Fly   159 TKLRAALAKPVMG-VSGIRREPVAVSRKEAETKK--------ELPETKKDSL---------EVKK 205
             :.|||||....| ..|:.::....:|:.|..|.        .:|..|.:|.         |.:|
Human    45 -RTRAALAVLKSGNPRGLAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEK 108

  Fly   206 DATRMP----------LIRGNSAVTTT---------------TSTMPTTMSLSSKRLAGIED--- 242
            :|.:.|          .:..|||::..               :...|.||.:|    ..:||   
Human   109 EAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMS----IILEDEKP 169

  Fly   243 IDANDKENLVLVSEYVNDIYDYLYQVELEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLA 307
            :..|:      |.:|..||:.||.::|::......::..|.::::.|||:|:||:.||..::.|.
Human   170 VSVNE------VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQ 228

  Fly   308 AETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIR 372
            .||..|||..|||:|..: ...|..|||||..|:.:|:|:||::||.:.:||:|||||||.:|:.
Human   229 NETLHLAVNYIDRFLSSM-SVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVL 292

  Fly   373 QMELQIFKAIDCNLSRPLPIHFLRRY---SKAAGAEDEHHTMSKYFIELASVDYE-MATYRPSEI 433
            :||..:.|.:..:|:.|....||.:|   .:.|..:.|  :::.:..||:.:|.: ...|.||.|
Human   293 RMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVE--SLAMFLGELSLIDADPYLKYLPSVI 355

  Fly   434 AAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIAKLARDAPQAKLKAIY 498
            |.|:..|:|:.:.|          :.|..:|...:.|:...|:|....:.:....|||...::|.
Human   356 AGAAFHLALYTVTG----------QSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIR 410

  Fly   499 NKYQGSKFQKIAL 511
            .||:.||:..::|
Human   411 EKYKNSKYHGVSL 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 50/126 (40%)
Cyclin_C 389..515 CDD:281044 32/127 (25%)
CCNA2NP_001228.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..45 2/33 (6%)
Cyclin_N2 28..166 CDD:406812 26/156 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..75 4/19 (21%)
CYCLIN_CCNA2_rpt1 175..305 CDD:410264 52/130 (40%)
CYCLIN_CCNA2_rpt2 309..419 CDD:410267 31/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146276
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 1 1.000 - - FOG0000121
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100199
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.