DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and CLN2

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_015067.1 Gene:CLN2 / 855819 SGDID:S000006177 Length:545 Species:Saccharomyces cerevisiae


Alignment Length:315 Identity:51/315 - (16%)
Similarity:96/315 - (30%) Gaps:123/315 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 ANDKENLVLVSEYVNDIY-------DYLYQVELEQPIHKD---HLAGQKEVSHKMRAVLIDW--- 296
            |..:..:.||.....|.|       :.|...|:.|..|::   ::..| ....|....|||.   
Yeast     4 AEPRPRMGLVINAKPDYYPIELSNAELLSHFEMLQEYHQEISTNVIAQ-SCKFKPNPKLIDQQPE 67

  Fly   297 INEVHLQFHLAAETFQLAVA-------------IIDRYLQVVKDTKRTYL----QLVGVTALFIA 344
            :|.|..:.::....|:|:|.             :.|||.     :||..|    :||..|.|::|
Yeast    68 MNPVETRSNIITFLFELSVVTRVTNGIFFHSVRLYDRYC-----SKRIVLRDQAKLVVATCLWLA 127

  Fly   345 TK--------------------------------------------YEE---------------- 349
            .|                                            ::|                
Yeast   128 AKTWGGCNHIINNVVIPTGGRFYGPNPRARIPRLSELVHYCGDGQVFDESMFLQMERHILDTLNW 192

  Fly   350 -LFPPAIGDFVFITDD-------------TYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSK 400
             ::.|.|.|:|...|:             ||..:...:.:.|:.:..|..:..       |.|..
Yeast   193 NIYEPMINDYVLNVDENCLMQYELYENQVTYDKQCSEKRQSQLSQDSDATVDE-------RPYQN 250

  Fly   401 AAGAEDEHH------TMSKYFIELASVDYEMATYRPSEIAAASLFLSLHLLNGNH 449
            ....|::..      .:.|:.|::::..|::..|...|::.....:.....|.:|
Yeast   251 EEEEEEDLKLKIKLINLKKFLIDVSAWQYDLLRYELFEVSHGIFSIINQFTNQDH 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 38/230 (17%)
Cyclin_C 389..515 CDD:281044 10/67 (15%)
CLN2NP_015067.1 COG5024 33..524 CDD:227357 45/286 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.