DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and CLB6

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_011623.3 Gene:CLB6 / 853003 SGDID:S000003341 Length:380 Species:Saccharomyces cerevisiae


Alignment Length:339 Identity:103/339 - (30%)
Similarity:171/339 - (50%) Gaps:32/339 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 SRKEAETKKELPETKKDSLE-----VKKDATRMPLIRGNSAVTTTTSTM--PTTMSLSSKRLAGI 240
            |..|.:...|:...|.|||:     :::|:|.:...|.......:|..:  .|...:...:...:
Yeast    42 STNEKKVLSEVNSNKIDSLQLPRGKLQRDSTHLEKTRKRQLSNDSTDPIEPKTVKKIKCHQWKNL 106

  Fly   241 EDIDANDKENLVLVSEYVNDIYDYLYQVELEQ-PIHKDHLAGQKEVSH---KMRAVLIDWINEVH 301
            :.|:.:|.   .:|:||.:.|:.:||:.|::. |.| ::|...:...|   .|||:||||:.|||
Yeast   107 DSIEMDDP---FMVAEYTDSIFSHLYEKEIQMLPTH-NYLMDTQSPYHLKSSMRALLIDWLVEVH 167

  Fly   302 LQFHLAAETFQLAVAIIDRYL--QVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDD 364
            .:||...||..||:.::||:|  .|||..|   |||:.:|.||||.|:||:..|.|.:|.::||.
Yeast   168 EKFHCLPETLFLAINLLDRFLSQNVVKLNK---LQLLCITCLFIACKFEEVKLPKITNFAYVTDG 229

  Fly   365 TYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTMSKYFIELASVDYEMATYR 429
            ..|...||:.||.:..::..|:|.|.|::|:||.|||.....|...|:|:.:|.:....:....:
Yeast   230 AATVEGIRKAELFVLSSLGYNISLPNPLNFIRRISKADNYCIETRNMAKFIMEYSICCNKFIHLK 294

  Fly   430 PSEIAAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITR-LIAKLARD--APQ 491
            ||.:||.|::::..:.|.|.:         |..|...||........|..: .|::|..|  .|.
Yeast   295 PSYLAAMSMYIARKIKNENSK---------WDETFIHYSGGIDIESDPAFKDFISELVEDIAVPD 350

  Fly   492 AKLKAIYNKYQGSK 505
            ..|.::..||:..|
Yeast   351 TNLDSLRLKYKKPK 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 53/132 (40%)
Cyclin_C 389..515 CDD:281044 32/120 (27%)
CLB6NP_011623.3 COG5024 1..380 CDD:227357 103/339 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I1086
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000121
OrthoInspector 1 1.000 - - mtm9224
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X94
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.