DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and AT1G20590

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001319051.1 Gene:AT1G20590 / 838648 AraportID:AT1G20590 Length:265 Species:Arabidopsis thaliana


Alignment Length:180 Identity:62/180 - (34%)
Similarity:97/180 - (53%) Gaps:10/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 VAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIRQMELQIF 379
            :.:|||:| .|....|..|||||||||.:|.||||:..|.:.|.:.|:|..|:.|::..||..:.
plant    63 IFVIDRFL-AVHQIVRKKLQLVGVTALLLACKYEEVSVPVVDDLILISDKAYSRREVLDMEKLMA 126

  Fly   380 KAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTMSKYFIELASVDYEMATYRPSEIAAASLFLSLHL 444
            ..:..|.|.|.|..|::|:.|||.::.:...:|.:.|||..|:|||..|.||::||::::.:...
plant   127 NTLQFNFSLPTPYVFMKRFLKAAQSDKKLEILSFFMIELCLVEYEMLEYLPSKLAASAIYTAQCT 191

  Fly   445 LNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIAKLARDAPQAKL 494
            |.       ||.:  |:.|..|::.|:...|....|.:......|...||
plant   192 LK-------GFEE--WSKTCEFHTGYNEEQLLACARKMVAFHHKAGTGKL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 29/71 (41%)
Cyclin_C 389..515 CDD:281044 32/106 (30%)
AT1G20590NP_001319051.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3347
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 1 1.000 - - FOG0000121
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.