DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and CYCB1;4

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_180244.1 Gene:CYCB1;4 / 817217 AraportID:AT2G26760 Length:387 Species:Arabidopsis thaliana


Alignment Length:366 Identity:119/366 - (32%)
Similarity:189/366 - (51%) Gaps:35/366 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 KPVMGVSG--IRREPVAVSRKEA-ETKKELPETKKDSLEVKKDA--------TRMPLIRGNSAVT 220
            :.|:|..|  :....||..:..| :.|:...:||.:.:.:..|.        :|...|||     
plant    32 RKVLGDIGNLVTGRDVATGKDVAKKAKQPQQQTKAEVIVISPDENEKCKPHFSRRTHIRG----- 91

  Fly   221 TTTSTMPTTMSLSSKRLAGIE----DIDANDKENLVLVSEYVNDIYDYLYQVELEQPIHKDHLAG 281
              |.|...|:...||..:|::    ||||.|..|.:...|||.||:.:...||.|..| ||::..
plant    92 --TKTFTATLRARSKAASGLKDAVIDIDAVDANNELAAVEYVEDIFKFYRTVEEEGGI-KDYIGS 153

  Fly   282 QKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATK 346
            |.|::.|||::||||:.:||.:|.|..||..|.:.::||:|.:.. ..|..|||:|:.|:.||.|
plant   154 QPEINEKMRSILIDWLVDVHRKFELMPETLYLTINLVDRFLSLTM-VHRRELQLLGLGAMLIACK 217

  Fly   347 YEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAA-GAEDEHHT 410
            |||::.|.:.|||.|:|:.|..:|:..||..|...::..::.|.|..||.||.||| ..:.|...
plant   218 YEEIWAPEVNDFVCISDNAYNRKQVLAMEKSILGQVEWYITVPTPYVFLARYVKAAVPCDAEMEK 282

  Fly   411 MSKYFIELASVDYEMATY-RPSEIAAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAH 474
            :..|..||..:.|.:... |||.:||::::.:..:|.     .|.|    ||.||..::.||...
plant   283 LVFYLAELGLMQYPIVVLNRPSMLAASAVYAARQILK-----KTPF----WTETLKHHTGYSEDE 338

  Fly   475 LRPITRLIAKLARDAPQAKLKAIYNKYQGSKFQKIALRTEL 515
            :....:::.||...|.::||.|::.||..|:..::||...|
plant   339 IMEHAKMLMKLRDSASESKLIAVFKKYSVSENAEVALLPSL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 50/126 (40%)
Cyclin_C 389..515 CDD:281044 39/127 (31%)
CYCB1;4NP_180244.1 CYCLIN_AtCycB-like_rpt1 110..255 CDD:410270 59/146 (40%)
CYCLIN_AtCycB-like_rpt2 260..377 CDD:410215 39/125 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3347
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I1359
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 1 1.000 - - FOG0000121
OrthoInspector 1 1.000 - - otm3050
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X94
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.