DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and ccnd2a

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001082914.1 Gene:ccnd2a / 799608 ZFINID:ZDB-GENE-070424-30 Length:298 Species:Danio rerio


Alignment Length:262 Identity:68/262 - (25%)
Similarity:113/262 - (43%) Gaps:38/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 QKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATK 346
            ||::...||.::..|:.||..:.....|.|.||:..:||:|.|| .|::..|||:|...:|:|:|
Zfish    48 QKDIQPFMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAVV-PTRKCNLQLLGAVCMFLASK 111

  Fly   347 YEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRR-YSKAAGAEDEHHT 410
            .:|..|.........||::...:::.:.||.:...:..||:...|..|:.. ..|....||:...
Zfish   112 LKETRPLTAEKLCIYTDNSIRPQELLEWELVVLGKLKWNLA
AVTPNDFIEHIMRKLPLPEDKLEL 176

  Fly   411 MSKY---FIELASVDYEMATYRPSEIAAASL---FLSLHLLNGNHRAGTGFNDRHWTPTLTFYSR 469
            :.|:   ||.|.:.|:..|.|.||.||..|:   ...|.|.:.||..        |...|     
Zfish   177 IRKHVQTFIALCATDFNFAMYPPSMIATGSVAAAICGLQLNSTNHSL--------WGDNL----- 228

  Fly   470 YSAAHLRPITRLIAKLAR------DAPQAKLKAIY--NKYQGSKFQKIALRTELTGALMDSIVGQ 526
                     |.|:||:..      .|.|.:::.:.  |..:|.:.|:...:.|..|....::..|
Zfish   229 ---------TELLAKITNTEVDVLKACQEQIERVLMNNLREGRRQQQKQQQQEQGGQRSKALDDQ 284

  Fly   527 SQ 528
            .|
Zfish   285 DQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 31/104 (30%)
Cyclin_C 389..515 CDD:281044 32/140 (23%)
ccnd2aNP_001082914.1 Cyclin_N 26..152 CDD:278560 31/104 (30%)
Cyclin_C 154..>257 CDD:281044 29/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.