DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycB and CCNJL

DIOPT Version :9

Sequence 1:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_078841.3 Gene:CCNJL / 79616 HGNCID:25876 Length:435 Species:Homo sapiens


Alignment Length:318 Identity:64/318 - (20%)
Similarity:106/318 - (33%) Gaps:96/318 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 NDIYDYLYQVELEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQ 323
            :|::..|.:.||:.|..:.|     ....|.|...:|.:..:.....|......|||.::|.::.
Human    13 SDVHCTLREKELKLPTFRAH-----SPLLKSRRFFVDILTLLSSHCQLCPAARHLAVYLLDHFMD 72

  Fly   324 VVKDTKRTYLQLVGVTALFIATKYEEL---------------------------------FPPAI 355
            ....|....|..|.|:.|.:|.....|                                 .||.:
Human    73 RYNVTTSKQLYTVAVSCLLLANGVSLLSPRLKCSGMISAHCNLHLPGSSNSPASAPHPPPTPPQV 137

  Fly   356 GDFVFITDD----------------------TYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRY 398
            .:.....:|                      |.|.:::...||.:.:|...||..|.|.|||..|
Human   138 AETTGKFEDREDHVPKLEQINSTRILSSQNFTLTKKELLSTELLLLEAFSWNLCLPTPAHFLDYY 202

  Fly   399 SKAAGAEDEHH-----------------TMSKYFIELASVDYEMATYRPSEIAAASLFLS---LH 443
            ..|:.::.:||                 ..:.||:|:...|:....::||.:|||.:..|   |.
Human   203 LLASVSQKDHHCHTWPTTCPRKTKECLKEYAHYFLEVTLQDHIFYKFQPSVVAAACVGASRICLQ 267

  Fly   444 LLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIA----KLARDAPQAKLKAI 497
            |            ..:||..|...|.||..||.....::.    .:.:||...|.:|:
Human   268 L------------SPYWTRDLQRISSYSLEHLSTCIEILLVVYDNVLKDAVAVKSQAL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 30/181 (17%)
Cyclin_C 389..515 CDD:281044 33/133 (25%)
CCNJLNP_078841.3 CYCLIN 14..>93 CDD:294043 19/83 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..142 2/21 (10%)
Cyclin_C 193..>295 CDD:281044 29/113 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146235
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.